DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Es2 and Ess2

DIOPT Version :8

Sequence 1:NP_572480.1 Gene:Es2 / 31780 FlyBaseID:FBgn0023506 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_071853.2 Gene:Ess2 / 27886 MGIID:107854 Length:480 Species:Mus musculus

Alignment Length:535 Identity:186/535 - (34%)
Similarity:271/535 - (50%) Gaps:101/535 - (18%)


  Fly    12 GTPGT-PGSLAMEVARVQNSALAEFKKPTAMVRHKNKPKILTEEKYIEEMSKIIQRDFFPDLERL 75
            ||||| .|:|.:..|...:...|..:...|.|. :::.::|.||:|||.:..:||||||||:|:|
Mouse     2 GTPGTSAGALFLSSASAPSRKRAAGEAGEAGVA-RSRQRVLDEEEYIEGLQTVIQRDFFPDVEKL 65

  Fly    76 RAQNDYLDAESRRDFVQMAEIRERY--SLGRISGTGRSTSRRNNA---MSPATFETP---VSQAK 132
            :||.:||:||...|..:|.:|..::  :||:||        |...   ::|||||||   ...|.
Mouse    66 QAQKEYLEAEENGDLERMRQIAIKFGSALGKIS--------REPPPPYVTPATFETPEVHPGSAV 122

  Fly   133 CSNTPLPNSRATDTPFSTDGSEKSDAEGRDTTAKLSLDAFLQKYTSEDNQSFQEIIETAEAKLRQ 197
            ..|.|.|..|..|     |..|..:.|.::...  |||.||.:||||||.|||||:|.|:.|...
Mouse   123 LGNKPRPQGRDLD-----DAGEAGEEEEKEPLP--SLDVFLSQYTSEDNASFQEIMEVAKEKSHA 180

  Fly   198 KYAVLYNHEKLSAEQLQRALMLPSIETQFEEPDPLRKIETWNYTNMNSIMYVPDGVEYTEEERVQ 262
            ::|.||..|:...::.:..|.|||.|.|..|... ..:|||.|...||:||.|:||  .:||  |
Mouse   181 RHAWLYQAEEEFEKRQKDNLELPSAEHQAIESSQ-AGVETWKYKAKNSLMYYPEGV--PDEE--Q 240

  Fly   263 LAERKQSIQHNATR-LPD-----------------EAKHRE----MDTKKLNDEVPQNGAGGATA 305
            |.::.:.|.|..|| |.|                 .|:|::    .|.|:|   :||.       
Mouse   241 LFKKPRQIVHKNTRFLRDPFSQALSRSQLQQAAALNAQHKQGKVGPDGKEL---IPQE------- 295

  Fly   306 TPKVRGFDLLRSPSPRPGEAFSPIMTWGEIDGTPFRLDGGDTP-LRPTQGPSFRINENSRRENIA 369
            :|:|.||..:.:|||.||...||:|||||::.||.|::|.::| :..|.||:|:|.|..|||.:.
Mouse   296 SPRVGGFGFVATPSPAPGVNESPLMTWGEVENTPLRVEGSESPYVDRTPGPTFKILEPGRRERLG 360

  Fly   370 IALAERVSERMRNQKQMALDTARRNIGSPLIRTNMERLASMSPAAQLLATGKLGIRGTPR-LR-- 431
            :.:|...:.:.|.:||.||.....|:.|   .|......:||||.|.|.: :...:.|.| ||  
Mouse   361 LKMANEAAAKNRAKKQEALRRVTENLAS---LTPKGLSPAMSPALQRLVS-RTASKYTDRALRAS 421

  Fly   432 HTPSPMSGRKRKV----------TPGVVRSTNTPILGEPKPKQQAKISTPAKNVTIDTGSTLTDD 486
            :||||......|.          ||....:|.||:..:|                    :::||:
Mouse   422 YTPSPARSSHLKTPAGGPQTPTSTPAPGSATRTPLTQDP--------------------ASITDN 466

  Fly   487 LLKIPTKRRTAADFF 501
            ||::|. ||.|:|||
Mouse   467 LLQLPA-RRKASDFF 480

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Es2NP_572480.1 Es2 47..417 CDD:286794 148/400 (37%)
Ess2NP_071853.2 Es2 37..405 CDD:286794 148/400 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C164723600
eggNOG 1 0.900 E1_KOG2627
Hieranoid 1 1.000
Homologene 1 1.000 H11184
Inparanoid 1 1.050 232 1.000 Inparanoid score I3398
Isobase 1 0.950 0 Normalized mean entropy S5412
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005018
OrthoInspector 1 1.000 T1082534
orthoMCL 1 0.900 OOG5_129811
Panther 1 1.100 LDO PTHR12940
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2483
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.