DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Es2 and TSSK2

DIOPT Version :8

Sequence 1:NP_572480.1 Gene:Es2 / 31780 FlyBaseID:FBgn0023506 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_443732.3 Gene:TSSK2 / 23617 HGNCID:11401 Length:358 Species:Homo sapiens

Alignment Length:280 Identity:60/280 - (21%)
Similarity:98/280 - (35%) Gaps:89/280 - (31%)


  Fly    20 LAMEVARVQNSALAEFKKPTAM---VRHKNKPKILTEEKYIEEMSKIIQRDFFPDLERLRAQNDY 81
            :.||:. ||...|...|...|:   |..|...::.:..||..::. |:.||       |:.:|..
Human    88 IIMELG-VQGDLLEFIKCQGALHEDVARKMFRQLSSAVKYCHDLD-IVHRD-------LKCENLL 143

  Fly    82 LDAESRRDF-VQMAEIRERYSLGRISGTGRSTSRRNNA--------------MSPATFETPVSQA 131
            ||    :|| :::::.          |..:...|.:|.              .:|...::...|.
Human   144 LD----KDFNIKLSDF----------GFSKRCLRDSNGRIILSKTFCGSAAYAAPEVLQSIPYQP 194

  Fly   132 K---------------CSNTPLPNS-----------RATDTPFSTD-GSEKSDAEGR----DTTA 165
            |               |.:.|..:|           ...|.|.|.: ..|..|...|    |.:.
Human   195 KVYDIWSLGVILYIMVCGSMPYDDSDIRKMLRIQKEHRVDFPRSKNLTCECKDLIYRMLQPDVSQ 259

  Fly   166 KLSLDAFLQ-------KYTSEDNQSFQEIIE---TAEAKLRQKYAVLYNH---EKLSAEQLQRAL 217
            :|.:|..|.       |..:..:.||:...|   .||.||..|..:..:|   .||.|:...|.|
Human   260 RLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLDTKTGLRPDHRPDHKLGAKTQHRLL 324

  Fly   218 MLPSIETQFEEPDPLRKIET 237
            ::|..|.:.|:    |..||
Human   325 VVPENENRMED----RLAET 340

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Es2NP_572480.1 Es2 47..417 CDD:286794 51/250 (20%)
TSSK2NP_443732.3 STKc_TSSK1_2-like 10..272 CDD:271067 39/206 (19%)
S_TKc 12..272 CDD:214567 39/206 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1378245at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.