DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2260 and WDR46

DIOPT Version :8

Sequence 1:NP_572441.1 Gene:CG2260 / 31732 FlyBaseID:FBgn0030000 Length:609 Species:Drosophila melanogaster
Sequence 2:XP_016866973.1 Gene:WDR46 / 9277 HGNCID:13923 Length:754 Species:Homo sapiens

Alignment Length:596 Identity:242/597 (41%)
Similarity:343/597 (57%) Gaps:68/597 (11%)


  Fly     4 VTPKG---RPKAKTPYKRYFD----------------GQKDTETGDGDLKHVKVFSKNRQNFTGD 49
            |.||.   :.|.|.| :||::                .:|:.|......|:..:..|:|      
Human    11 VPPKKDKLQTKRKKP-RRYWEEETVPTTAGASPGPPRNKKNRELRPQRPKNAYILKKSR------ 68

  Fly    50 FISMINK----TKKPRPQKAPAKP-----TKEELEARPKKNPIPKEILDKYSRGEQVQPKGVKTR 105
                |:|    .||||..|.|...     |::..   |...|:|.|::.|:.|.:    |..|..
Human    69 ----ISKKPQVPKKPREWKNPESQRGLSGTQDPF---PGPAPVPVEVVQKFCRID----KSRKLP 122

  Fly   106 HFKEQQTRKEVYLEYATEQ-----AARTELLLQETAGQLQADEGETTAEFRQSQIAENVDIQSSA 165
            |.| .:||..:.:..|.|:     |||:||||.|..|.|:.::||.||:..|:.|.|.|||.|:|
Human   123 HSK-AKTRSRLEVAEAEEEETSIKAARSELLLAEEPGFLEGEDGEDTAKICQADIVEAVDIASAA 186

  Fly   166 KHFNLNM-EFGPYRMRYTKNGRHLLLGGKRGHVAAFDWVTKRLHCEFNAMESVEDVQWLHVPTMY 229
            |||:||: :|||||:.|::.||||..||:||||||.|||||:|.||.|.||:|.|:::||...:.
Human   187 KHFDLNLRQFGPYRLNYSRTGRHLAFGGRRGHVAALDWVTKKLMCEINVMEAVRDIRFLHSEALL 251

  Fly   230 AVAQKSWVYFYDKKGTELHCIKRLNRVNRLDFLPYHFLLAAGNSAGYASWLDVSIGELVGNFNTG 294
            ||||..|::.||.:|.|||||:|.:||.||:|||:|||||..:..|:.::||||:|::|...|..
Human   252 AVAQNRWLHIYDNQGIELHCIRRCDRVTRLEFLPFHFLLATASETGFLTYLDVSVGKIVAALNAR 316

  Fly   295 LGDIRMLRHNPRNGVLCIGGGRGVVSMWSPKVREPLAKLLCHSTAMSALAVEPKGQYLVTAGLDR 359
            .|.:.::..||.|.|:.:|...|.||:|||.::|||||:|||...:.|:||:..|.|:.|:|||.
Human   317 AGRLDVMSQNPYNAVIHLGHSNGTVSLWSPAMKEPLAKILCHRGGVRAVAVDSTGTYMATSGLDH 381

  Fly   360 AVKVWDIRMLVHDKPLTHFQLRLPANELDVSQRGMLALSQGTYLETYSDLLSGGGSGDGTRLPYI 424
            .:|::|:|...  :||:...|...|..|..||||:|....|..:..::.  .|..|......||:
Human   382 QLKIFDLRGTY--QPLSTRTLPHGAGHLAFSQRGLLVAGMGDVVNIWAG--QGKASPPSLEQPYL 442

  Fly   425 RQRCDAFVHGLRFCPYEDVLGVSTAKGFQSLLVPGSGEPNFDAMEDNPYETSKQRREHEVHALLE 489
            ..|....||||:|||:||||||....|..|:||||:||||||.:|.|||.:.|||:|.||.||||
Human   443 THRLSGPVHGLQFCPFEDVLGVGHTGGITSMLVPGAGEPNFDGLESNPYRSRKQRQEWEVKALLE 507

  Fly   490 KIPPELITLDPQEITGVDAPTLQEKIDAKRKLFHL------KAPRINMKSRHKMKGRGGTAKAAR 548
            |:|.|||.|||:.:..||..:|::  ..|.::..|      |||   .:.:.|.|||..||...:
Human   508 KVPAELICLDPRALAEVDVISLEQ--GKKEQIERLGYDPQAKAP---FQPKPKQKGRSSTASLVK 567

  Fly   549 NKQIVKDAKRK 559
            .|:.|.|.:.:
Human   568 RKRKVMDEEHR 578

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2260NP_572441.1 WD40 177..398 CDD:295369 106/221 (48%)
WD40 <181..371 CDD:225201 94/190 (49%)
WD40 repeat 181..210 CDD:293791 20/29 (69%)
WD40 repeat 218..253 CDD:293791 17/35 (49%)
WD40 repeat 256..292 CDD:293791 18/36 (50%)
WD40 repeat 299..334 CDD:293791 16/35 (46%)
WD40 repeat 340..376 CDD:293791 14/36 (39%)
BING4CT 422..500 CDD:198101 49/78 (63%)
WDR46XP_016866973.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1272
Hieranoid 1 1.000
Homologene 1 1.000 H3981
Inparanoid 1 1.050 421 1.000 Inparanoid score I1762
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D222308at33208
OrthoFinder 1 1.000 FOG0004095
OrthoInspector 1 1.000 T1075451
orthoMCL 1 0.900 OOG5_127796
Panther 1 1.100 LDO PTHR14085
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1624
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.