DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and Kcnip2

DIOPT Version :8

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_006527533.1 Gene:Kcnip2 / 80906 MGIID:2135916 Length:286 Species:Mus musculus

Alignment Length:220 Identity:63/221 (29%)
Similarity:104/221 (47%) Gaps:37/221 (17%)


  Fly    85 AAAAALQNKRQQRQRRMD--------ELSGKVN-PKLLDSLRKKTRFTKDELDALCRIYRKLVSN 140
            :|.||..:.|..|.|.:|        |||...: |:.|:.|:::|:||:.||..|   ||...:.
Mouse    72 SALAAPASLRPHRPRPLDPDSVEDEFELSTVCHRPEGLEQLQEQTKFTRRELQVL---YRGFKNE 133

  Fly   141 CQYAAKTLASSSSSAAIAKPHAAVEGIDRIVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPL 205
            |                  |...|...:   |:::....|...........:|.::|..|:| .:
Mouse   134 C------------------PSGIVNEEN---FKQIYSQFFPQGDSSNYATFLFNAFDTNHDG-SV 176

  Fly   206 RLEGWLIGLSTFLRGTPAERAAFCFRVYDLNTDGFITKDEMFTLLRNCLIKQPQDEDP---DEGV 267
            ..|.::.|||..||||..:|..:.|.:||||.||.|||:||..::::......:...|   :|..
Mouse   177 SFEDFVAGLSVILRGTIDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPALREEAP 241

  Fly   268 KDLVEIVLKKFDLDKDGKVSLEDFM 292
            ::.||...:|.|.:|||.|::|:|:
Mouse   242 REHVESFFQKMDRNKDGVVTIEEFI 266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 24/67 (36%)
EF-hand_7 229..292 CDD:290234 24/66 (36%)
Kcnip2XP_006527533.1 FRQ1 109..275 CDD:227455 52/184 (28%)
EFh 160..222 CDD:238008 25/63 (40%)
EFh 196..267 CDD:238008 25/72 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.