DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and guca1g

DIOPT Version :8

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001011660.1 Gene:guca1g / 494572 ZFINID:ZDB-GENE-050120-1 Length:187 Species:Danio rerio

Alignment Length:123 Identity:31/124 (25%)
Similarity:63/124 (51%) Gaps:7/124 (6%)


  Fly   172 FRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYDLN 236
            ||.:.........|.:.||.||.|:|...:.:...:| ::..:...|||...:|..:.|:|||.:
Zfish    39 FRRIFGVQSSSEEEALYMETIFKSFDTNRDNVIDFME-FVAAVHLVLRGNLEDRLKWSFKVYDRD 102

  Fly   237 TDGFITKDEMFTLLR-NCLIKQPQ-DEDPDEGVKDLVEIVLKKFDLDKDGKVSLEDFM 292
            .:|.:.:.|:..::| .|.:|:.: :..|.|    :.:.:.:..|.:.||::||.:|:
Zfish   103 ENGKLDRQEVIHVIRILCKLKKNRINMTPVE----ICDRIFELLDENNDGQISLSEFL 156

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 17/66 (26%)
EF-hand_7 229..292 CDD:290234 17/65 (26%)
guca1gNP_001011660.1 EF-hand_8 30..80 CDD:290545 10/42 (24%)
EFh 59..117 CDD:238008 15/59 (25%)
EFh 91..158 CDD:238008 18/71 (25%)
EF-hand_7 92..157 CDD:290234 17/70 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.