| Sequence 1: | NP_572437.2 | Gene: | CG2256 / 31727 | FlyBaseID: | FBgn0029995 | Length: | 324 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_649673.1 | Gene: | sunz / 40811 | FlyBaseID: | FBgn0037462 | Length: | 220 | Species: | Drosophila melanogaster | 
| Alignment Length: | 227 | Identity: | 53/227 - (23%) | 
|---|---|---|---|
| Similarity: | 93/227 - (40%) | Gaps: | 53/227 - (23%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly   112 LLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEGIDRIVFRELL 176 
  Fly   177 HSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYD------L 235 
  Fly   236 N-------TDGFITKDEMFTLLRNCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLEDFMG 293 
  Fly   294 TVTAEPLLIEAFGQCLPTDS--AVVSFFSTLQ 323 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG2256 | NP_572437.2 | EFh | 228..292 | CDD:238008 | 21/76 (28%) | 
| EF-hand_7 | 229..292 | CDD:290234 | 20/75 (27%) | ||
| sunz | NP_649673.1 | EF-hand_7 | 113..181 | CDD:290234 | 21/81 (26%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45438937 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D106617at6656 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR23055 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.950 | |||||