DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and HPCAL1

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001245286.1 Gene:HPCAL1 / 3241 HGNCID:5145 Length:193 Species:Homo sapiens

Alignment Length:220 Identity:52/220 - (23%)
Similarity:103/220 - (46%) Gaps:35/220 - (15%)


  Fly   101 MDELSGKVNPKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVE 165
            |.:.:.|:.|::|..||:.|.||..||.   ..|:..:.:|...                |..|:
Human     1 MGKQNSKLRPEVLQDLRENTEFTDHELQ---EWYKGFLKDCPTG----------------HLTVD 46

  Fly   166 GIDRIVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCF 230
                 .|:::..:.|.........|.:|.::|...:| .:....::|.||...||...::..:.|
Human    47 -----EFKKIYANFFPYGDASKFAEHVFRTFDTNGDG-TIDFREFIIALSVTSRGKLEQKLKWAF 105

  Fly   231 RVYDLNTDGFITKDEMFTLLR------NCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLE 289
            .:|||:.:|:|::.||..:::      :.::|.|:||...|...|.   :.::.|.:.|||:|||
Human   106 SMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDK---IFRQMDTNNDGKLSLE 167

  Fly   290 DFMGTVTAEPLLIEAFGQCLPTDSA 314
            :|:....::|.::... ||.|:.::
Human   168 EFIRGAKSDPSIVRLL-QCDPSSAS 191

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 21/69 (30%)
EF-hand_7 229..292 CDD:290234 21/68 (31%)
HPCAL1NP_001245286.1 FRQ1 13..179 CDD:227455 46/193 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.