DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and GUCA1B

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_002089.4 Gene:GUCA1B / 2979 HGNCID:4679 Length:200 Species:Homo sapiens


Alignment Length:193 Identity:40/193 - (20%)
Similarity:75/193 - (38%) Gaps:52/193 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 FTKDELDALCRI--------YRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEGIDRIVFRELLHS 178
            |:.:|.:|...|        |:|.|..|....                         :|......
Human     5 FSWEEAEAAGEIDVAELQEWYKKFVMECPSGT-------------------------LFMHEFKR 44

  Fly   179 TFDIVTEE---ILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYDLNTDGF 240
            .|.:..:|   ..:|.:|.::||..:.....|| ::..|:..||||...:..:.|::||.:.:|.
Human    45 FFKVTDDEEASQYVEGMFRAFDKNGDNTIDFLE-YVAALNLVLRGTLEHKLKWTFKIYDKDGNGC 108

  Fly   241 ITKDEMFTLL-----------RNCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLEDFM 292
            |.:.|:..::           |....:|.|...|:|    :|:.:....|.:.||::||.:|:
Human   109 IDRLELLNIVEGIYQLKKACRRELQTEQGQLLTPEE----VVDRIFLLVDENGDGQLSLNEFV 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 17/74 (23%)
EF-hand_7 229..292 CDD:290234 17/73 (23%)
GUCA1BNP_002089.4 FRQ1 20..174 CDD:227455 36/178 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.