DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and Vsnl1

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_036818.2 Gene:Vsnl1 / 24877 RGDID:3966 Length:191 Species:Rattus norvegicus

Alignment Length:211 Identity:45/211 - (21%)
Similarity:91/211 - (43%) Gaps:38/211 - (18%)


  Fly   101 MDELSGKVNPKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVE 165
            |.:.:.|:.|::::.|.|.|.|.:.||.   :.|:..:.:|......|..               
  Rat     1 MGKQNSKLAPEVMEDLVKSTEFNEHELK---QWYKGFLKDCPSGRLNLEE--------------- 47

  Fly   166 GIDRIVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCF 230
                  |::|....|.........:..|.::||..:| .:....::..||...||:..::..:.|
  Rat    48 ------FQQLYVKFFPYGDASKFAQHAFRTFDKNGDG-TIDFREFICALSITSRGSFEQKLNWVF 105

  Fly   231 RVYDLNTDGFITKDEMFTLLR------NCLIKQPQDED---PDEGVKDLVEIVLKKFDLDKDGKV 286
            .:|||:.||.||:.||..::.      ..:|....:||   |::    .|:.:..|.|.:||.::
  Rat   106 NMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQ----RVDKIFSKMDKNKDDQI 166

  Fly   287 SLEDFMGTVTAEPLLI 302
            :|::|.....::|.::
  Rat   167 TLDEFKEAAKSDPSIV 182

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 20/72 (28%)
EF-hand_7 229..292 CDD:290234 20/71 (28%)
Vsnl1NP_036818.2 FRQ1 15..181 CDD:227455 42/194 (22%)
EFh 65..125 CDD:238008 18/60 (30%)
EFh 100..176 CDD:238008 21/79 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.