DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and LOC798868

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_021326617.1 Gene:LOC798868 ID: Length:608 Species:Danio rerio

Alignment Length:501 Identity:117/502 (23%)
Similarity:189/502 (38%) Gaps:70/502 (14%)


  Fly    34 SGRQRLKYIMANPSEKSTQ---LSRQMALTVMETENVTLDQHGMYHYEGG----WPK---EVNFN 88
            :||:|...:  .|| |.||   |.|::.....||:......|.....|..    .||   |.:..
Zfish   102 AGRRRSHRL--GPS-KITQVDFLPREVVSYCKETQTPNAAHHSEEDEEEDEEVTEPKAGPETDLQ 163

  Fly    89 DEEQT----QRHRKKVEREDSWGEQVL-----------SMIRTTMSVAEQNNTLNIYQNFFADLP 138
            :||::    :.|.:::..|:.  :|||           |:.....::||.:|....|..  .||.
Zfish   164 EEEESKDTKEGHPRELTEEEK--QQVLHSEEFLIFFDRSIRVMERALAEDSNIFFDYSG--RDLE 224

  Fly   139 PELGHDIKMRFRARVANVFHD-LWLPARQLRSIEWMPNNSRQFMTQYTNHFAKGERLRPVTDEPF 202
            .:.| |::......::.:|:| .|...|.:..::|.|......:..|.|:          .|.|.
Zfish   225 DKEG-DMQGGSSLSLSRLFYDEHWSKHRVITCLDWSPQYPELLVASYNNN----------EDAPH 278

  Fly   203 GGTNGFYVWDVK-NPLKPRITYDSKQQVSLAKICPKDENNMVGGTGLGQVCLW-GTFKGGLPIRN 265
            .......||::| ....|...|..:..|..........|.:||||..||:.|| .......|::.
Zfish   279 EPDGVALVWNMKFKKTTPEYIYHCQSPVVSVGFALFHPNLLVGGTYSGQIVLWDNRSHRRTPVQR 343

  Fly   266 CPLE-VSHRETTSALCWVHSKSNTEFYSGSLDGSIKYWDTRDLKMPMQELLLEPEPQERQSRMDS 329
            .||. .:|......:..|.:::.....:.|.||.:..|....|..|.:.:.|.      .::...
Zfish   344 TPLSAAAHTHPVYCVNVVGTQNANNLITVSTDGRMCSWSLDMLSQPQESMELV------YNKSKP 402

  Fly   330 HGVTVLEFEYTIPVRFIIGSDMGHVFVGNRKGMTP--METLLAHYQLFVGPVRSINRN----PFF 388
            ..||.:.|.......:|:||:.|.|:..:|.|...  .|....|.    |||..|:.:    |..
Zfish   403 VAVTGMAFPTGDVNNYIVGSEEGTVYTASRHGSKAGICEMFEGHQ----GPVTGISCHSAVGPVD 463

  Fly   389 VKNFLVTG--DWRARIWSEEVKDSPSTMYFRKNAQILCGA-WSTGRCSLFVTGDINGVVDFWDLL 450
            ..:..||.  ||..::||  .|.:.....|..||..:... ||....|||...|..|.:|.|:|.
Zfish   464 FSHLFVTSSFDWTVKLWS--TKQNKPLYSFEDNADYVYDVMWSPVHPSLFAAVDGMGRLDLWNLN 526

  Fly   451 LHHRKPIRSVDFK--VAIADLVFRPEGDLLAIGLKNGDTHIMTLDE 494
            .....|..||..:  .|:..:.:...|..:|:|...|...|..:.|
Zfish   527 NDTEVPSASVTVEGAPALNRVRWASGGREVAVGDSEGRVWIYDVGE 572

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 67/264 (25%)
WD40 211..>488 CDD:225201 71/291 (24%)
WD40 repeat 229..269 CDD:293791 13/41 (32%)
WD40 repeat 277..325 CDD:293791 8/48 (17%)
WD40 repeat 332..369 CDD:293791 11/39 (28%)
WD40 repeat 379..415 CDD:293791 10/42 (24%)
WD40 repeat 422..447 CDD:293791 8/26 (31%)
LOC798868XP_021326617.1 Dynein_IC2 109..135 CDD:314442 9/29 (31%)
WD40 246..569 CDD:330360 81/345 (23%)
WD40 repeat 253..302 CDD:293791 11/59 (19%)
WD40 repeat 308..346 CDD:293791 11/38 (29%)
WD40 repeat 355..398 CDD:293791 8/49 (16%)
WD40 repeat 406..452 CDD:293791 14/50 (28%)
WD40 repeat 459..492 CDD:293791 9/35 (26%)
WD40 repeat 498..539 CDD:293791 13/41 (32%)
WD40 repeat 544..568 CDD:293791 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000393
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.