DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and DNAI2

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001340096.1 Gene:DNAI2 HGNCID:18744 Length:649 Species:Homo sapiens

Alignment Length:644 Identity:200/645 (31%)
Similarity:322/645 (50%) Gaps:63/645 (10%)


  Fly     6 FIYSRERRRFGRQCRFQDRN-ELMVSVHPSGRQRLKYIMANPSEKSTQLSRQMALTVMETENVTL 69
            ::|.::|..||:||.|.||. ||.:.:.|:.....:::..||.:...|.|..|:.....:|...:
Human     5 YVYVKKRSEFGKQCNFSDRQAELNIDIMPNPELAEQFVERNPVDTGIQCSISMSEHEANSERFEM 69

  Fly    70 DQHGMYHYEGGWPKEVNFNDEEQTQRHRKKVEREDSWGEQVLSMIRTTMSVAEQNNTLNIYQNFF 134
            :..|:.|.||||||:||..:.|||.|.|||||:::::...::.:........:|||.::||:.:|
Human    70 ETRGVNHVEGGWPKDVNPLELEQTIRFRKKVEKDENYVNAIMQLGSIMEHCIKQNNAIDIYEEYF 134

  Fly   135 ADLPPELGHDIKMRFRARVANVFHDLWLPARQLRSIEWMPNNSRQFMTQYT-NHFAKGERLRPVT 198
            .|  .|....::....|:..|||.|.....|....:.|.|:.:|:....|: ..|.:.       
Human   135 ND--EEAMEVMEEDPSAKTINVFRDPQEIKRAATHLSWHPDGNRKLAVAYSCLDFQRA------- 190

  Fly   199 DEPFGGTNGFYVWDVKNPLKPRITYDSKQQVSLAKICPKDENNMVGGTGLGQVCLWGTFKGGLPI 263
              |.|.::..|:||::||.||.:.......:...:..|||.:.::||...||:..|.|.||.|..
Human   191 --PVGMSSDSYIWDLENPNKPELALKPSSPLVTLEFNPKDSHVLLGGCYNGQIACWDTRKGSLVA 253

  Fly   264 RNCPLEVSHRETTSALCWVHSKSNTEFYSGSLDGSIKYWDTRDLKMPMQELLLEPEPQERQSRMD 328
            ....:|.|||:......|:.||:.||.:|.|.||.:.:||.|.:..|.:.::|:...:|:..  :
Human   254 ELSTIESSHRDPVYGTIWLQSKTGTECFSASTDGQVMWWDIRKMSEPTEVVILDITKKEQLE--N 316

  Fly   329 SHGVTVLEFEYTIPVRFIIGSDMGHVFVGNRKGMTPMETLLAHYQLFVGPVRSINRNPFFVKNFL 393
            :.|...||||.|:|.:|::|::.|.|...|||..|..|.::..:....||:.::.||||:.||||
Human   317 ALGAISLEFESTLPTKFMVGTEQGIVISCNRKAKTSAEKIVCTFPGHHGPIYALQRNPFYPKNFL 381

  Fly   394 VTGDWRARIWSEEVKDSPSTMYFRKN-AQILCGAWSTGRCSLFVTGDINGVVDFWDLLLHHRKPI 457
            ..|||.||||||:.::| |.|:.:.: |.:...|||..|.::|.|..::|.:|.||.:.....| 
Human   382 TVGDWTARIWSEDSRES-SIMWTKYHMAYLTDAAWSPVRPTVFFTTRMDGTLDIWDFMFEQCDP- 444

  Fly   458 RSVDFKV---AIADLVFRPEGDLLAIGLKNGDTHIMTLDESMRQATGKEKALMAAMFEREIVRCK 519
             ::..||   |:..|..:..|.|:|.|.:.|.|.::.:...:......||.:.::|||||..|.|
Human   445 -TLSLKVCDEALFCLRVQDNGCLIACGSQLGTTTLLEVSPGLSTLQRNEKNVASSMFERETRREK 508

  Fly   520 LLEARYDEVRLKRKTLQMAEEERVRKQQQLAPTLELDPDNPDQFVMMIEGDEEFRTAITEFQDII 584
            :||||:.|:|||.|......:|. :..::||..||          .::...||      ||.|||
Human   509 ILEARHREMRLKEKGKAEGRDEE-QTDEELAVDLE----------ALVSKAEE------EFFDII 556

  Fly   585 LSVERKRSKRQVIMERTVFEEWNPADEKLQGEPVVYTKPERKVQTSGNYDKR--TSGEP 641
            .: |.|:.:...|              ||...|.::.       |||...||  .||.|
Human   557 FA-ELKKKEADAI--------------KLTPVPALFC-------TSGERKKRHCLSGSP 593

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 87/253 (34%)
WD40 211..>488 CDD:225201 97/281 (35%)
WD40 repeat 229..269 CDD:293791 12/40 (30%)
WD40 repeat 277..325 CDD:293791 15/48 (31%)
WD40 repeat 332..369 CDD:293791 15/37 (41%)
WD40 repeat 379..415 CDD:293791 20/36 (56%)
WD40 repeat 422..447 CDD:293791 8/25 (32%)
DNAI2NP_001340096.1 WD40 <166..494 CDD:225201 107/342 (31%)
WD40 repeat 166..215 CDD:293791 14/58 (24%)
WD40 repeat 220..259 CDD:293791 12/39 (31%)
WD40 repeat 267..307 CDD:293791 14/40 (35%)
WD40 repeat 314..361 CDD:293791 16/49 (33%)
WD40 repeat 367..403 CDD:293791 20/37 (54%)
WD40 repeat 410..435 CDD:293791 8/25 (32%)
WD40 repeat 455..489 CDD:293791 7/34 (21%)
WTX 479..>627 CDD:312801 44/155 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4268
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D217312at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12442
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.