DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and dic1

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001342791.1 Gene:dic1 PomBaseID:SPBC646.17c Length:544 Species:Schizosaccharomyces pombe

Alignment Length:564 Identity:113/565 (20%)
Similarity:201/565 (36%) Gaps:157/565 (28%)


  Fly    48 EKSTQLSRQMALTVMETENVTLDQHGMYHYEGGWPKEVNFNDEEQTQRHRKKVEREDSWGEQVLS 112
            ::..::.|...|.:...||.| |.....:.||  ||:::   |:|......|:.:..:...|   
pombe     6 KREIEIKRAKLLLLKNKENCT-DAVSSSNKEG--PKQIS---EDQLSNFLCKILKPTNLTPQ--- 61

  Fly   113 MIRTTMSVAEQNNTL---------NIYQNF-----FADLPPELGHDIKMRFRARVANVFHDLWLP 163
                |.|:..:::.|         ::||::     .::..|.:...:.:|..::  ::.|....|
pombe    62 ----TYSLESKSSNLVSDCELKISSVYQSYSSTFNVSNHVPSISKTVNIRETSK--HLKHSTKAP 120

  Fly   164 ARQLRS----IEWMPN---------------NSRQFMTQYT-----------------NH----- 187
            ...|.:    |:.:.|               .|.|..|.||                 ||     
pombe   121 KCSLPTSALEIDHLNNFLHSSAKILDRALCDQSNQLFTDYTVKKKSKKNKSQLEENGLNHLFTFQ 185

  Fly   188 --------------------------FAK-GERLRPVTDEPFGGTNGF-YVWDVKNPLKPRITYD 224
                                      :|| .|.||         |.|. .||:.:....|.....
pombe   186 DEKITLNSVVNSISYSSFFEELLITSYAKPKEALR---------TRGLAIVWNQRWKNSPESVLK 241

  Fly   225 SKQQVSLAKICPKDENNMVGGTGLGQVCLWGTFKGGLPIR-NCPLEVSHRETTSALCWVHSKSNT 288
            ::.::::.|..|.....:.||...|||.||...:|..|:. ...:...|.|..:.:.::::..:.
pombe   242 ARSEITVCKPSPFHPQLIAGGAYNGQVFLWDLRQGQYPVSFTTIISGGHLEPVTDITYINNPPSN 306

  Fly   289 EFYSGSLDGSIKYWDTRDLKMPMQELLLEPEPQERQSRMDSHG----VTVLEFEYTIP---VRFI 346
            ...:.|.||.:..|:......|.:.:.|       .|::||..    .|.|.|   ||   :.|:
pombe   307 NIVTCSTDGLVHIWEPDMFSRPSETICL-------SSQVDSSSQCIPATCLSF---IPENNMEFL 361

  Fly   347 IGSDMGHVFVGNR------KGMTPMETLLAHYQLFVGPV---RSINRNPFFVKN--FLVTG--DW 398
            :|::.|.:..|.|      |.:.|.......:.:|:..:   .|.::|.|..||  |.:|.  ||
pombe   362 VGAEDGKLQRGYRSDYSETKAVQPSNVSYEGHNVFISGIDVMTSNSQNVFLEKNKDFALTSSFDW 426

  Fly   399 RARIW-------------SEEVKDS---PSTMYFRKNAQILCGAWSTGRCSLFVTGDINGVVDFW 447
            ..|:|             |.::.:.   .|...|...|.:....|.......|.:.|..|.::.|
pombe   427 TVRLWQCSPSRNQHELVPSNDLDEQVIINSCKTFTHKAMVFDVKWCVSEPCCFASVDALGNLNLW 491

  Fly   448 DLLLHHRKPIRS--VDFKVAIADLVFRPEGDLLAIGLKNGDTHI 489
            ||......|:.|  .|.| .:..:.::||...||.|..||:.||
pombe   492 DLQKDVEAPVTSDIPDGK-PLNKIAWQPEKRNLACGGLNGNVHI 534

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 63/291 (22%)
WD40 211..>488 CDD:225201 70/316 (22%)
WD40 repeat 229..269 CDD:293791 11/41 (27%)
WD40 repeat 277..325 CDD:293791 6/48 (13%)
WD40 repeat 332..369 CDD:293791 12/46 (26%)
WD40 repeat 379..415 CDD:293791 13/59 (22%)
WD40 repeat 422..447 CDD:293791 4/25 (16%)
dic1NP_001342791.1 WD40 223..536 CDD:330360 74/324 (23%)
WD40 repeat 247..289 CDD:293791 11/42 (26%)
WD40 repeat 294..339 CDD:293791 7/52 (13%)
WD40 repeat 348..390 CDD:293791 12/45 (27%)
WD40 repeat 397..453 CDD:293791 12/56 (21%)
WD40 repeat 466..504 CDD:293791 9/38 (24%)
WD40 repeat 511..535 CDD:293791 9/25 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000393
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
21.960

Return to query results.
Submit another query.