| Sequence 1: | NP_572435.1 | Gene: | CG1571 / 31725 | FlyBaseID: | FBgn0029993 | Length: | 651 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001342791.1 | Gene: | dic1 / 5802757 | PomBaseID: | SPBC646.17c | Length: | 544 | Species: | Schizosaccharomyces pombe | 
| Alignment Length: | 564 | Identity: | 113/564 - (20%) | 
|---|---|---|---|
| Similarity: | 201/564 - (35%) | Gaps: | 157/564 - (27%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    48 EKSTQLSRQMALTVMETENVTLDQHGMYHYEGGWPKEVNFNDEEQTQRHRKKVEREDSWGEQVLS 112 
  Fly   113 MIRTTMSVAEQNNTL---------NIYQNF-----FADLPPELGHDIKMRFRARVANVFHDLWLP 163 
  Fly   164 ARQLRS----IEWMPN---------------NSRQFMTQYT-----------------NH----- 187 
  Fly   188 --------------------------FAK-GERLRPVTDEPFGGTNGF-YVWDVKNPLKPRITYD 224 
  Fly   225 SKQQVSLAKICPKDENNMVGGTGLGQVCLWGTFKGGLPIR-NCPLEVSHRETTSALCWVHSKSNT 288 
  Fly   289 EFYSGSLDGSIKYWDTRDLKMPMQELLLEPEPQERQSRMDSHG----VTVLEFEYTIP---VRFI 346 
  Fly   347 IGSDMGHVFVGNR------KGMTPMETLLAHYQLFVGPV---RSINRNPFFVKN--FLVTG--DW 398 
  Fly   399 RARIW-------------SEEVKDS---PSTMYFRKNAQILCGAWSTGRCSLFVTGDINGVVDFW 447 
  Fly   448 DLLLHHRKPIRS--VDFKVAIADLVFRPEGDLLAIGLKNGDTHI 489 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG1571 | NP_572435.1 | WD40 | 210..462 | CDD:295369 | 62/290 (21%) | 
| WD40 | 211..>488 | CDD:225201 | 70/315 (22%) | ||
| WD40 repeat | 229..269 | CDD:293791 | 11/40 (28%) | ||
| WD40 repeat | 277..325 | CDD:293791 | 6/47 (13%) | ||
| WD40 repeat | 332..369 | CDD:293791 | 12/45 (27%) | ||
| WD40 repeat | 379..415 | CDD:293791 | 13/58 (22%) | ||
| WD40 repeat | 422..447 | CDD:293791 | 4/24 (17%) | ||
| dic1 | NP_001342791.1 | WD40 | 223..536 | CDD:330360 | 74/323 (23%) | 
| WD40 repeat | 247..289 | CDD:293791 | 11/41 (27%) | ||
| WD40 repeat | 294..339 | CDD:293791 | 7/51 (14%) | ||
| WD40 repeat | 348..390 | CDD:293791 | 12/44 (27%) | ||
| WD40 repeat | 397..453 | CDD:293791 | 12/55 (22%) | ||
| WD40 repeat | 466..504 | CDD:293791 | 8/37 (22%) | ||
| WD40 repeat | 511..535 | CDD:293791 | 9/24 (38%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1587 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| 3 | 2.770 | |||||