DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and dnai2a

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_017213955.1 Gene:dnai2a ZFINID:ZDB-GENE-070410-46 Length:567 Species:Danio rerio

Alignment Length:592 Identity:176/593 (30%)
Similarity:299/593 (50%) Gaps:70/593 (12%)


  Fly    16 GRQCRFQDRNELMVSVHPSGRQRLKYIMANPSEKSTQLSR---QMALTVMETENVTLDQHGMYHY 77
            ||.|:|.::..:...:.|.....|:||........||.|:   |..:|...||.|:   |||.|.
Zfish    24 GRWCKFSEKAVVHDDIPPDPSLALEYIDRGTCHVGTQFSKFWSQHEVTPFHTEQVS---HGMNHV 85

  Fly    78 EGGWPKEVNFNDEEQTQRHRKKVEREDSWGEQVLSMIRTTMSVAEQNNTLNIY---QNFFADLPP 139
            |||||:.::.|::|.|.|:||||::::|:.:.|:.    |:||.| |....::   |.:|.|   
Zfish    86 EGGWPETISANNDELTLRYRKKVQKDESYQQTVIE----TVSVME-NYKQKVFEKSQVYFKD--- 142

  Fly   140 ELGHDIKMR---FRARVANVFHDLWLPARQLRSIEWMPNNSRQFMTQYT-NHFAKGERLRPVTDE 200
              ...:..|   ..||:.||..|.....|...|:.|.|.::.:....|: ..|.:|         
Zfish   143 --NRVVVKREDMASARIINVLRDPKKEKRAATSLSWHPVDNHKLAVAYSCVEFQRG--------- 196

  Fly   201 PFGGTNGFYVWDVKNPLKPRITYDSKQQVSLAKICPKDENNMVGGTGLGQVCLWGTFKGGLPIRN 265
            |...::..|:|:::|..:|.:|..|...:...:...|:.:.::||:..||:..|.|..|..|::.
Zfish   197 PKNMSSDSYIWNIENNKQPEMTLKSVSPLVCLEYNLKNISILIGGSYNGQIGYWDTRSGSQPVQI 261

  Fly   266 CPLEVSHRETTSALCWVHSKSNTEFYSGSLDGSIKYWDTRDLKMPMQELLLEPEPQERQSRMDSH 330
            ..:|.||::....:.|:.:|..||.:|.|.||.:.:||.|::..|.::|:|:|...:..:  ::.
Zfish   262 SAIEHSHKDPVYKVIWLQTKIGTEAFSASTDGQVLFWDIRNMSEPTKQLILDPAKSKNLN--NAF 324

  Fly   331 GVTVLEFEYTIPVRFIIGSDMGHVFVGNRKGMTPMETLLAHYQLFVGPVRSINRNPFFVKNFLVT 395
            |...:||:.|:| :|::|::.|.|.:.|||..|..|.::..|...:|||.::.|||||.|.||..
Zfish   325 GAFSMEFDNTMP-KFLVGTEQGLVVLCNRKLETTDEPIVCTYSGHLGPVYAVQRNPFFPKYFLTV 388

  Fly   396 GDWRARIWSEEVKDSP--STMYFRKNAQILCGAWSTGRCSLFVTGDINGVVDFWDLLLHHRKPIR 458
            .||.||||||:::.|.  ||.|  ..:.::.|.||..|.::|.|..::|.:|.||:||..:.|:.
Zfish   389 ADWTARIWSEDIRLSSIMSTKY--HTSHLMDGCWSPVRPAVFFTVKMDGTLDVWDILLKQKDPVL 451

  Fly   459 SVDFKV---AIADLVFRPEGDLLAIGLKNGDTHIMTLDESMRQATGKEKALMAAMFEREIVRCKL 520
            |:  ||   .:..:..:.:..|:..|.:.|...::.:..::......||.|::.|||||..|.|:
Zfish   452 SL--KVCDETLYSIRVKNDSPLMCCGSQLGTVTLLKMSPNLCTLQSNEKGLVSEMFERETKREKI 514

  Fly   521 LEARYDEVRLKRKTLQMAEEE-RVRKQQQLAPTLELDPDNPDQFVMMIEGDEEFRTAITEFQDII 584
            |||.|.|....:::....||: |...|:.||.|                 :.||..||       
Zfish   515 LEAFYKERNQMKQSCPKEEEDGRAELQELLAET-----------------ETEFFEAI------- 555

  Fly   585 LSVERKR 591
             :||:|:
Zfish   556 -NVEKKK 561

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 84/254 (33%)
WD40 211..>488 CDD:225201 89/282 (32%)
WD40 repeat 229..269 CDD:293791 9/40 (23%)
WD40 repeat 277..325 CDD:293791 15/48 (31%)
WD40 repeat 332..369 CDD:293791 13/37 (35%)
WD40 repeat 379..415 CDD:293791 20/38 (53%)
WD40 repeat 422..447 CDD:293791 8/25 (32%)
dnai2aXP_017213955.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D217312at33208
OrthoFinder 1 1.000 FOG0000393
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12442
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.