DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and dync1i2b

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_009300385.1 Gene:dync1i2b ZFINID:ZDB-GENE-090121-1 Length:645 Species:Danio rerio

Alignment Length:482 Identity:108/483 (22%)
Similarity:177/483 (37%) Gaps:98/483 (20%)


  Fly    82 PKE-VNFNDEEQ--TQRHRKKVEREDSWGEQVLSMIRTTMSVAEQNNTLN--------------- 128
            ||| |:::.|.|  ||.|.|:.|.|    |:.|::::..|...|:.::..               
Zfish   160 PKEMVSYSKETQTPTQTHHKEDEEE----EEDLAVMQPVMEPQEEKDSQKEEDEASPHELTEEEK 220

  Fly   129 ---IYQNFFADLPPELGHDIKMRFRA--RVANVFHDL---------------------------- 160
               ::...|...   ..|..::..||  ...:||.|.                            
Zfish   221 QQILHSEEFVTF---FDHSSRIMERALSEQVDVFFDYSGRDLQDKEGESQAGAKLSLNRQFADER 282

  Fly   161 WLPARQLRSIEWMPNNSRQFMTQYTNHFAKGERLRPVTDEPFGGTNGFYVWDVK-NPLKPRITYD 224
            |...|.:..::|.|......:..|.::       .....||.|..   .||::| ....|...:.
Zfish   283 WSKHRVVTCLDWSPQYPELLVASYCSN-------EEAPHEPDGVA---LVWNMKYKKTTPEYVFH 337

  Fly   225 SKQQVSLAKICPKDENNMVGGTGLGQVCLWGTFKG-GLPIRNCPLEVS-HRETTSALCWVHSKSN 287
            .:..|..|.......|.:||||..||:.||..... ..|::..||..| |......:..|.:::.
Zfish   338 CQSAVMSAAFAQFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLSASAHTHPVYCVNVVGTQNA 402

  Fly   288 TEFYSGSLDGSIKYWDTRDLKMPMQELLLEPEPQERQSRMDSHGVTVLEFEYTIPVRFIIGSDMG 352
            ....|.|.||.:..|....|..|...|    |...:||:  |..||.:.|.......|::||:.|
Zfish   403 HNLISISTDGKMCSWSLDMLSTPQDSL----ELVFKQSK--SVAVTSMSFPLGDVNNFVVGSEDG 461

  Fly   353 HVFV----GNRKGMTPMETLLAHYQLFVGPVRSIN----RNPFFVKNFLVTG--DWRARIWSEEV 407
            .|:.    |::.|::  |....|:    ||:..::    ..|....:..||.  ||..::||  .
Zfish   462 SVYTACRHGSKAGIS--EMFEGHH----GPITGLDCHTAAGPVDFSHLFVTSSFDWTVKLWS--T 518

  Fly   408 KDSPSTMYFRKNAQILCGA-WSTGRCSLFVTGDINGVVDFWDLLLHHRKPIRS--VDFKVAIADL 469
            |::.....|..|:..:... ||....:||...|..|.:|.|:|......|..|  |:...|:..:
Zfish   519 KNNKPLYSFEDNSDYVYDVMWSPTHPALFACVDGVGHLDLWNLNNETEVPTASVTVEGNPALNRV 583

  Fly   470 VFRPEGDLLAIGLKNGDTHIMTLDESM 496
            .:...|..:|:|...|..||..:.|.:
Zfish   584 RWAHSGREVAVGDSEGQLHIYDVGEQI 610

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 69/268 (26%)
WD40 211..>488 CDD:225201 73/293 (25%)
WD40 repeat 229..269 CDD:293791 14/41 (34%)
WD40 repeat 277..325 CDD:293791 11/48 (23%)
WD40 repeat 332..369 CDD:293791 11/41 (27%)
WD40 repeat 379..415 CDD:293791 8/42 (19%)
WD40 repeat 422..447 CDD:293791 7/26 (27%)
dync1i2bXP_009300385.1 Dynein_IC2 145..173 CDD:288403 6/13 (46%)
Spore_coat_CotO 153..>256 CDD:290858 23/103 (22%)
WD40 283..605 CDD:295369 84/346 (24%)
WD40 repeat 289..338 CDD:293791 10/59 (17%)
WD40 repeat 343..382 CDD:293791 12/39 (31%)
WD40 362..>606 CDD:225201 65/258 (25%)
WD40 repeat 391..434 CDD:293791 10/47 (21%)
WD40 repeat 442..490 CDD:293791 13/54 (24%)
WD40 repeat 497..528 CDD:293791 9/33 (27%)
WD40 repeat 534..575 CDD:293791 12/41 (29%)
WD40 repeat 580..606 CDD:293791 6/26 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000393
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.