DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and dync1i1

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_009290517.1 Gene:dync1i1 ZFINID:ZDB-GENE-061215-62 Length:647 Species:Danio rerio

Alignment Length:525 Identity:115/526 (22%)
Similarity:190/526 (36%) Gaps:111/526 (21%)


  Fly    30 SVHPSGRQRLKYIMANPSEKSTQLSRQMALTVMETENVTLDQHGMYHYEGGWPKEVNFN------ 88
            |||....|||            ..|:.:.:..|..|.||..:..........|:|.:..      
Zfish   141 SVHGCRMQRL------------GASKIVQIDFMPKELVTYSKETQTPVASNQPEEEDDEELSVPK 193

  Fly    89 --------DEEQTQR----HRKKVEREDSWGEQVL----------SMIRTTMSVAEQNNTLNIYQ 131
                    :||:||.    |.:::..|:.  ||::          ..||....|..::..:    
Zfish   194 SEPASQQLEEEKTQEVEEVHPRELTNEEK--EQIVHSEDFLFFFDRSIRVVERVLAEDKDI---- 252

  Fly   132 NFF----ADLPPELGHDIKMRFRARVANVFHD-LWLPARQLRSIEWMPNNSRQFMTQY-TNHFAK 190
             ||    .|:..:.| |::..........|:| .|...|.:.|::|.|......:..| ||.   
Zfish   253 -FFDYSGRDMEDKEG-DLQAGSNLSFNRHFYDEHWSKHRVVTSLDWSPQYPELLVASYNTNE--- 312

  Fly   191 GERLRPVTDEPFGGTNGFYVWDVK-NPLKPRITY---DSKQQVSLAKICPKDENNMVGGTGLGQV 251
                    |.|........||::| ....|...:   .|...|..|:..|   |.::|||..||:
Zfish   313 --------DAPHEPDGVVLVWNMKFKKATPEYIFHCQSSVMSVGFAQFHP---NLVIGGTYSGQI 366

  Fly   252 CLW-GTFKGGLPIRNCPLE-VSHRETTSALCWVHSKSNTEFYSGSLDGSIKYWDTRDLKMPMQEL 314
            .:| .......|::..||. .:|......:..|.:::.....:.|.||.:..|....|..|.:.:
Zfish   367 AMWDNRSHRRTPVQRTPLSATAHTHPVYCVNVVGTQNANNLITVSTDGKMCSWSLDMLSQPQESM 431

  Fly   315 LL---EPEPQERQSRMDSHGVTVLEFEYTIPVRFIIGSDMGHVFVGNRKG------------MTP 364
            .|   :.:|.         .||.:.|..:....:::||:.|.|:..:|.|            ..|
Zfish   432 ELIYNKSKPV---------AVTCMAFPASDVNNYVVGSEEGTVYTASRHGSKAGIGEIFDGHQGP 487

  Fly   365 METLLAHYQLFVGPVRSINRNPFFVKNFLVTGDWRARIWSEEVKDSPSTMYFRKNAQILCGA-WS 428
            :..:..|..  ||||..  .:.|...:|    ||..::||  .|.:.....|..||..:... ||
Zfish   488 VTGISCHNA--VGPVDF--SHLFTTSSF----DWTVKLWS--TKHNKPLYSFEDNADYVYDVMWS 542

  Fly   429 TGRCSLFVTGDINGVVDFWDLLLHHRKPIRSVDFK--VAIADLVFRPEGDLLAIGLKNGDTHIMT 491
            ....:||.|.|.||.:|.|:|..:...|..||..:  .|:..:.:...|..:|:|...|...|..
Zfish   543 PVHPALFATVDGNGRLDLWNLNNYTEVPSASVSVEGGCALNRVRWASGGREVAVGDSEGRVWIYD 607

  Fly   492 LDESM 496
            :.|.:
Zfish   608 VGEQL 612

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 67/274 (24%)
WD40 211..>488 CDD:225201 71/301 (24%)
WD40 repeat 229..269 CDD:293791 13/41 (32%)
WD40 repeat 277..325 CDD:293791 9/51 (18%)
WD40 repeat 332..369 CDD:293791 10/49 (20%)
WD40 repeat 379..415 CDD:293791 8/36 (22%)
WD40 repeat 422..447 CDD:293791 9/26 (35%)
dync1i1XP_009290517.1 Dynein_IC2 147..175 CDD:288403 8/40 (20%)
WD40 215..608 CDD:225201 96/434 (22%)
WD40 284..607 CDD:295369 83/356 (23%)
WD40 repeat 292..337 CDD:293791 12/56 (21%)
WD40 repeat 347..388 CDD:293791 13/44 (30%)
WD40 repeat 394..437 CDD:293791 8/43 (19%)
WD40 repeat 443..490 CDD:293791 10/47 (21%)
WD40 repeat 498..530 CDD:293791 11/40 (28%)
WD40 repeat 536..574 CDD:293791 13/38 (34%)
WD40 repeat 582..608 CDD:293791 5/26 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000393
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.