DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and dnai1.2

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001074027.1 Gene:dnai1.2 ZFINID:ZDB-GENE-070112-1302 Length:660 Species:Danio rerio

Alignment Length:601 Identity:117/602 (19%)
Similarity:223/602 (37%) Gaps:136/602 (23%)


  Fly    23 DRNELMVSVHP-----SGRQRLKYIMANPSEKSTQLSRQMALTVMETENVTLDQHGMYHYEGGWP 82
            |....:::.|.     .|.:||:.:...|.::..:::.|  ...::..:.||:         ..|
Zfish   125 DEGRRLMAKHTEREDCGGDERLENVPIKPGKREQKVTNQ--FNFIDRASQTLN---------NLP 178

  Fly    83 KEVNFNDE---------------------EQTQRHRKKVEREDSW---GEQVLSMIRTTMSVAEQ 123
            :|::...|                     |:.||..|..|:::|.   .|:..|..:...:.|:.
Zfish   179 REISCQTEPPPRANFSATANQWEIYDFYVEELQRREKSKEKQESQFPNKEEDRSKKKMIQAEAQS 243

  Fly   124 NNTLN-----------IYQNFFADLPPELGH--DIKMRFRARVANVFHDLW------LPARQLRS 169
            ::...           :.||.|.::..:..:  |....||.....:. .||      .....:.:
Zfish   244 DDISQLAKPAEIIERMVNQNIFDEVAQDFMYFEDAADEFRGEKGTLL-PLWKFQYDKAKGLSVTA 307

  Fly   170 IEWMPNNSRQFMTQYTNHFAKGERLRPVTDEPFGGTNGFYVWDVKNPLKPRITYDSKQQVSLAKI 234
            :.|  |:.      |::.||.|......|.:. .|...||.  :|||..|...:::...|....|
Zfish   308 LCW--NHI------YSDLFAVGLGSYEFTQQE-RGMLLFYT--LKNPSFPEFIFNTDSGVMCVDI 361

  Fly   235 CPKDENNMVGGTGLGQVCLWGTF----KGGLPIRNCPLEVSHRETTSALCWVHSK-----SNTEF 290
              .::.:.:...||...|: ..:    |...|:.|.  ..|..:.|.|:..|..:     ||..|
Zfish   362 --HEQLSYLVAVGLYDGCV-SVYDLRKKSDQPMYNS--IASSGKHTGAVWQVKWQKDDLDSNHNF 421

  Fly   291 YSGSLDGSIKYWD--------TRDLKMPMQELLLEPEPQERQSRMDSHGVTVLEFEYTIPVRFII 347
            :|.|.||.:..|.        |..:|:|.    ::..|.:.::.:.:.| |.|:|.......|::
Zfish   422 FSVSTDGRVVSWTLVKHEIVFTDIIKLPP----VDKVPDDLKNVVATAG-TSLDFHKQKDHHFLV 481

  Fly   348 GSDMGHVFVGNRKGMTP-METLLAHYQLFVGPVRSINRNPFFVKNFLVTG-DWRARIWSEEVKDS 410
            |::.|.:..|::...:. :|...||:.    .|..:..|||....|:..| ||..:||...: :|
Zfish   482 GTEAGKIHKGSKYYSSKFLEMYDAHFM----TVSCVRWNPFHPNVFISCGWDWMVKIWDHTI-NS 541

  Fly   411 PSTMYFRKNAQILCGAWSTGRCSLFVTGDINGVVDFWDLLLHHRKPI---RSVDFKVAIADLVFR 472
            | ...|...:.:...|||....::|.....:|.|..:||.::..:.:   :.|..|..:..:.|.
Zfish   542 P-VFTFELKSSVTDVAWSPHSSTVFAAVTADGKVHVFDLSINKYEALCQQKVVSKKTRLLHIEFN 605

  Fly   473 PEGDLLAIGLKNGDTHIMTLDESMRQATGKEKALMAAMFEREIVRCKLLEARYDEVRLKRKTLQM 537
            |...::.:|...|....:.|..::|:.. |||                          |.:.|..
Zfish   606 PVHPIIIVGDDRGRVISLKLSPNLRKKP-KEK--------------------------KGQELPK 643

  Fly   538 AEEERVRKQQQLAPTL 553
            ..|..:.|.:||..:|
Zfish   644 GPEVEIAKMEQLLSSL 659

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 61/274 (22%)
WD40 211..>488 CDD:225201 66/299 (22%)
WD40 repeat 229..269 CDD:293791 8/44 (18%)
WD40 repeat 277..325 CDD:293791 14/61 (23%)
WD40 repeat 332..369 CDD:293791 8/38 (21%)
WD40 repeat 379..415 CDD:293791 12/37 (32%)
WD40 repeat 422..447 CDD:293791 6/25 (24%)
dnai1.2NP_001074027.1 WD40 <296..650 CDD:225201 84/408 (21%)
WD40 354..620 CDD:295369 62/282 (22%)
WD40 repeat 357..397 CDD:293791 7/45 (16%)
WD40 repeat 405..485 CDD:293791 19/85 (22%)
WD40 repeat 511..547 CDD:293791 12/38 (32%)
WD40 repeat 552..591 CDD:293791 8/39 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.