DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and wdr78

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001018595.1 Gene:wdr78 ZFINID:ZDB-GENE-050522-322 Length:778 Species:Danio rerio

Alignment Length:498 Identity:103/499 (21%)
Similarity:167/499 (33%) Gaps:118/499 (24%)


  Fly    84 EVNFNDEEQTQRHRKKVEREDSWG--------EQVLSMIRTTMSVAEQNNTLNIYQNFFADLP-- 138
            :|:.|....::||...:......|        .|.||::.|..:|:..:..:   :.....||  
Zfish   284 DVSANTVVSSERHEATIPESSPEGHLVHPKRSNQSLSVVSTVSTVSGSSTHI---EKMACVLPLD 345

  Fly   139 -----------PELGHDIKMRFRARVANVFHDLWLPARQLRSIE-----WMPNNSRQFMTQYTN- 186
                       .:|..|:.:..|..:||||.......|||..||     .|......:..|..| 
Zfish   346 EEPDLQLILQSDKLKQDLALMERVVLANVFQPKLAAYRQLPIIEDPDCVQMVMEEESWTEQSKNS 410

  Fly   187 HFAKGERLRPVTDEPFGGTN-GFYVWDVKNPLKPRITYDSKQQVSLAKICPKDENNMVGGTGLGQ 250
            |....|||...:.|...|.| ...||:.|||....:.|.   ||..     |:.|:       |.
Zfish   411 HCPFLERLWDFSCELTMGRNVTCMVWNKKNPDLLAVGYG---QVEF-----KNPNS-------GL 460

  Fly   251 VCLW---------------------------------GTFKGGLPIRN------CPLEVS----- 271
            ||.|                                 |.:.|.:.|.|      .|:..|     
Zfish   461 VCCWSLKNPTWPDRVFYCESGVTALDFSASNANQLAVGMYDGTIAIYNVQTSEQTPITDSSDCAN 525

  Fly   272 -HRETTSALCWVHSKSNTEFYSG------SLDGSIKYW------DTRDL-KMPMQELLLEPEPQE 322
             |......|.|:..:.......|      |.||.|..|      :..|| |:.:.:|      |.
Zfish   526 LHTSPVWQLTWIDHEDGLAADKGEILVSVSSDGRISKWIHYKSMECVDLMKLKIHDL------QW 584

  Fly   323 RQSRMDSHGVTVLEFEYTIPVRFIIGSDMGHVFVGNRKGMTPMETLLAHYQLFVGPVRSINRNPF 387
            :|...........:|.......:::|::.||:   ::...:..|..|..|:....||..:..:||
Zfish   585 KQHISSLTPGMCFDFHPNDSKIYLVGTEEGHI---HKCSSSYNEQYLDSYKAHKRPVYKVTWSPF 646

  Fly   388 FVKNFL-VTGDWRARIWSEEVKDSPSTMYFRKNAQILCGAWSTGRCSLFVTGDINGVVDFWDLLL 451
            ....|| .:.||..::|.::::  ...|.|....:::.....:..|:........|.|:.|||.:
Zfish   647 CSDVFLSCSSDWTIQLWRQDLQ--IPVMGFTSGQRVVFDIMWSPHCATVFGAVSEGKVEIWDLRV 709

  Fly   452 HHRKP--IRSVDFKVAIADLVFRPEGDLLAIGLKNGDTHIMTL 492
            ....|  :......|....|:|.||.|.:.:|...|...:..|
Zfish   710 SSLDPTLVNWTSPGVNPTALLFSPETDCVLVGDSEGQVTVYKL 752

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 60/313 (19%)
WD40 211..>488 CDD:225201 67/338 (20%)
WD40 repeat 229..269 CDD:293791 12/79 (15%)
WD40 repeat 277..325 CDD:293791 14/61 (23%)
WD40 repeat 332..369 CDD:293791 5/37 (14%)
WD40 repeat 379..415 CDD:293791 9/37 (24%)
WD40 repeat 422..447 CDD:293791 3/25 (12%)
wdr78NP_001018595.1 WD40 repeat 431..473 CDD:293791 14/57 (25%)
WD40 <459..754 CDD:225201 59/306 (19%)
WD40 479..751 CDD:295369 54/283 (19%)
WD40 repeat 483..526 CDD:293791 6/43 (14%)
WD40 repeat 531..576 CDD:293791 10/45 (22%)
WD40 repeat 589..624 CDD:293791 4/38 (11%)
WD40 repeat 638..675 CDD:293791 10/39 (26%)
WD40 repeat 681..707 CDD:293791 5/26 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.