DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and Dnai1

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001019513.1 Gene:Dnai1 RGDID:1565671 Length:705 Species:Rattus norvegicus

Alignment Length:587 Identity:112/588 (19%)
Similarity:219/588 (37%) Gaps:140/588 (24%)


  Fly    26 ELMVSVHPSGRQRLKYIMANPSEKSTQLSR--------QMALTVMETENVTLDQHGMYHYEGGWP 82
            |||..|.|..|:.....  |.||:::|...        ||........:.|.:|..:|       
  Rat   181 ELMAPVQPKERKLTNQF--NFSERASQTFNNPLRDRECQMEPPPRTNFSATANQWEIY------- 236

  Fly    83 KEVNFNDEEQTQRHRKKVEREDSWGEQVLSM-IRTTMSVAEQNNTLN------------IYQNFF 134
             :...::.|:.::.::|.:.:....::...| :|...|:..|::.:.            :.||.:
  Rat   237 -DAYVDELEKLEKTKEKEKTKTPVAKKTEKMAMRKLTSMESQSDDITKVTQAAKIVERMVNQNTY 300

  Fly   135 ADLPPELGHDIKMRFRARVANVFHD-------LWL----PARQL--RSIEWMPNNSRQFMTQYTN 186
            .|:..:      .::....|:.:.|       ||.    .|::|  .::.|.|        :|.:
  Rat   301 DDVAQD------FKYYEDAADEYRDQEGTLLPLWKFQNDKAKRLAVTALCWNP--------KYKD 351

  Fly   187 HFAKGERLRPVTDEPFGGTNGF--------YVWDVKNPLKPRITYDSKQQVSLAKIC---PKDEN 240
            .||.|.           |:..|        .::.:|||..|...:.|:..:    :|   ..|..
  Rat   352 LFAVGH-----------GSYDFMKQSRGMLLLYSMKNPSFPEYMFSSESGI----MCLDMHMDHP 401

  Fly   241 NMV------GGTGL-------GQVCLWGTFKGGLPIRNCPLEVSHRETTSALCWVHS--KSNTEF 290
            .:|      |...:       .|.|...|.|.|          .|.:....:.|...  ..|..|
  Rat   402 YLVVVGYYDGNVAIYNLKKPHSQPCFRSTSKSG----------KHTDPVWQVKWQKDDMDHNLNF 456

  Fly   291 YSGSLDGSIKYW---DTRDLKMPMQELLLEPEPQERQSRMDSHGV---TVLEFEYTIPVRFIIGS 349
            :|.|.||.|..|   .:..:.:.:.:|..|....|....:..|.|   |..:|...|...|::|:
  Rat   457 FSVSSDGRIVSWTLVKSELVHIDVIKLKDEGSTTEIPEGLQLHTVGCGTAFDFHKEIDYLFLVGT 521

  Fly   350 DMGHVFVGNRKGMTP-METLLAHYQLFVGPVRSINRNPFFVKNFL-VTGDWRARIWSEEVKDSPS 412
            :.|.::..::...:. ::|..||..    .|.::..||:..:.|: .:.||..:||...:| :|.
  Rat   522 EEGKIYKCSKSYSSQFLDTYDAHNM----AVDAVLWNPYHARVFISCSSDWTVKIWDHAIK-TPM 581

  Fly   413 TMYFRKNAQILCGAWSTGRCSLFVTGDINGVVDFWDLLLHHRKPIRS----VDFKVAIADLVFRP 473
            .:| ..||.:...||:....::|.....:|....:||.::..:.|.:    ...|..|..:.|.|
  Rat   582 FIY-DLNAAVGDVAWAPYSSTVFAAVTTDGKAHVFDLAVNKYEAICNQPVVAKKKNKITHVQFNP 645

  Fly   474 EGDLLAIGLKNGDTHIMTLDESMRQATGKEKALMAAMFEREIVRCKLLE-ARYDEV-----RLKR 532
            ...::.:|...|....:.|..::|:...::|.       :|:.:...:| |:.|::     .:|.
  Rat   646 IHPIIIVGDDRGHITCLKLSPNLRKMPKEKKG-------QEVQKGPAVEIAKLDKLLNLVREVKT 703

  Fly   533 KT 534
            ||
  Rat   704 KT 705

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 58/282 (21%)
WD40 211..>488 CDD:225201 64/307 (21%)
WD40 repeat 229..269 CDD:293791 9/56 (16%)
WD40 repeat 277..325 CDD:293791 12/53 (23%)
WD40 repeat 332..369 CDD:293791 8/41 (20%)
WD40 repeat 379..415 CDD:293791 10/37 (27%)
WD40 repeat 422..447 CDD:293791 4/25 (16%)
Dnai1NP_001019513.1 WD40 325..683 CDD:225201 80/404 (20%)
WD40 repeat 340..386 CDD:293791 12/65 (18%)
WD40 <358..616 CDD:295369 57/278 (21%)
WD 1 386..426 6/44 (14%)
WD40 repeat 392..433 CDD:293791 8/41 (20%)
WD 2 435..478 10/43 (23%)
WD40 repeat 440..494 CDD:293791 12/54 (22%)
WD40 repeat 505..542 CDD:293791 7/37 (19%)
WD 3 543..583 12/45 (27%)
WD40 repeat 548..587 CDD:293791 11/41 (27%)
WD 4 585..625 8/40 (20%)
WD40 repeat 590..631 CDD:293791 7/41 (17%)
WD 5 633..672 8/39 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.