DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and wdr34

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_012823678.1 Gene:wdr34 XenbaseID:XB-GENE-953027 Length:503 Species:Xenopus tropicalis

Alignment Length:426 Identity:89/427 (21%)
Similarity:145/427 (34%) Gaps:92/427 (22%)


  Fly   142 GHDIKMRFRARVANVFHDLWLP-----ARQLRSIEWMPNNSRQFMTQYTNHFAKGERLRPVTDEP 201
            |:::....:.......|.|..|     ..|:.|:.|  |::...:......|..|:         
 Frog   101 GYEVNWEEQHEQVTCLHSLQYPDALEQQLQVTSVSW--NSTGSIIACSYGRFGDGD--------- 154

  Fly   202 FGGTNGFYV--WDVK----NPLKPRITYDSKQQVSLAKICPKDENNMVGGTGLGQVCLWGTFKGG 260
             ..|...||  |::.    |...|....|....|......|...:.:.||...|.|.:|.|.:..
 Frog   155 -WSTEKSYVCTWNLDRRGFNANNPDTVLDVPSSVMCLAWHPSQPSLIAGGLFNGDVLVWDTSRTD 218

  Fly   261 LPI--RNCPLEVSHRETTSALCWVHSKS---NTEFYSGSLDGSIKYWDTRD-------------- 306
            .|:  |...:..:|.:....:.|:..||   ..:.:|.|.||.|..|....              
 Frog   219 DPLIGRTGHVGDTHTDAVYQVGWMQEKSQGHRHQVFSVSSDGKILVWQMEKEGHLVLLDGFALVA 283

  Fly   307 LKMPMQELLLEPEPQERQSRMDSH-GVTVLEFEYTIPVRFIIGSDMGHVFVGNRKGMTPMETLLA 370
            .::|....:.:|      .|.|:. |||.|.:.:..|..||:|.:.|::.    |..:.::||..
 Frog   284 QQIPSNTKIHKP------GRGDTAVGVTCLSYSHFDPSLFIVGVEGGYLL----KCSSSVQTLAP 338

  Fly   371 ---------------HYQLFVGPVRSINRNPFFVKNFLVTG-DWRARIWSE-EVKDSPSTMYFRK 418
                           .:....|||.|:..:||....||..| |..|.::|. :.|...|....:|
 Frog   339 INMGSSVPLRAPAQFTFSPHGGPVYSVTCSPFHRNLFLSAGTDGHAHLYSMLQAKPLVSLQLSQK 403

  Fly   419 NAQILCGAWSTGRCSLFVTGDINGVVDFWDLLLHHRK------------PIRSVDFKVAIADLVF 471
              .:....||..|..:|.....:|.|...|.....:|            |:..::|..|      
 Frog   404 --YLFSIRWSPVRPLVFAAASGDGEVVLVDFAKSFQKPSLCIKQTASGRPVYCLEFNHA------ 460

  Fly   472 RPEGDLLAIGLKNGDTHIMTLDESMRQATGKEKALM 507
              :..|||.|...|...|..|.....:...:|.||:
 Frog   461 --QSQLLAAGDGTGTVKIWQLSSDFIEQRARETALL 494

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 65/307 (21%)
WD40 211..>488 CDD:225201 71/330 (22%)
WD40 repeat 229..269 CDD:293791 10/42 (24%)
WD40 repeat 277..325 CDD:293791 11/65 (17%)
WD40 repeat 332..369 CDD:293791 11/37 (30%)
WD40 repeat 379..415 CDD:293791 12/38 (32%)
WD40 repeat 422..447 CDD:293791 6/25 (24%)
wdr34XP_012823678.1 WD40 68..484 CDD:225201 86/415 (21%)
WD40 repeat 131..182 CDD:293791 11/63 (17%)
WD40 184..481 CDD:295369 69/317 (22%)
WD40 repeat 188..227 CDD:293791 9/39 (23%)
WD40 repeat 236..297 CDD:293791 11/67 (16%)
WD40 repeat 305..355 CDD:293791 10/54 (19%)
WD40 repeat 362..399 CDD:293791 12/37 (32%)
WD40 repeat 405..446 CDD:293791 8/41 (20%)
WD40 repeat 452..477 CDD:293791 8/33 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.