DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and sw

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_477075.2 Gene:sw FlyBaseID:FBgn0003654 Length:663 Species:Drosophila melanogaster

Alignment Length:474 Identity:114/475 (24%)
Similarity:193/475 (41%) Gaps:75/475 (16%)


  Fly    83 KEVNFNDEEQTQ------RHRKKVEREDSWGEQVLSMIRTTMSVAEQNNTLNIYQNFFADLPPEL 141
            ||||...|||.|      ..::.|.|.....|:.||            ..::||.::......|.
  Fly   237 KEVNELSEEQKQMIILSENFQRFVVRAGRVIERALS------------ENVDIYTDYIGGGDSEE 289

  Fly   142 GHDIKMRFRARVANVFHD-LWLPARQLRSIEWMPNNSRQFMTQYTNHFAKGERLRPVTDEPFGGT 205
            .:|.:...|..:..||:| .|...|.:.|::|..:.....:..|.|:       ....:||.|..
  Fly   290 ANDERSHARLSLNRVFYDERWSKNRCITSMDWSTHFPELVVGSYHNN-------EESPNEPDGVV 347

  Fly   206 NGFYVWDVK-NPLKPRITYDSKQQVSLAKICPKDENNMVGGTGLGQVCLW-GTFKGGLPIRNCPL 268
               .||:.| ....|...:..:..|........:.|.::|||..||:.|| ...:...||:..||
  Fly   348 ---MVWNTKFKKSTPEDVFHCQSAVMSTCFAKFNPNLILGGTYSGQIVLWDNRVQKRTPIQRTPL 409

  Fly   269 E-VSHRETTSALCWVHSKSNTEFYSGSLDGSIKYWDTRDLKMPMQELLLEPEPQERQSRMDSHGV 332
            . .:|......|..|.:::.....|.|.||.:..|....|..|...|    |.|:|||:  :..:
  Fly   410 SAAAHTHPVYCLQMVGTQNAHNVISISSDGKLCSWSLDMLSQPQDTL----ELQQRQSK--AIAI 468

  Fly   333 TVLEFEYTIPVRFIIGSDMGHVFVGNRKGMTPMETLLAHYQLFVGPVRSINR-----NPFFVKNF 392
            |.:.|........::||:.|:|:..:|.|:  ...:...|:..:||:..|:.     :|.|...|
  Fly   469 TSMAFPANEINSLVMGSEDGYVYSASRHGL--RSGVNEVYERHLGPITGISTHYNQLSPDFGHLF 531

  Fly   393 LVTG-DWRARIWSEEVKDSPSTMYFRKNAQ-ILCGAWSTGRCSLFVTGDINGVVDFWDLLLHHRK 455
            |.:. ||..::||  :||:.....|..|:. ::..|||....:||...|.:|.:|.|:|      
  Fly   532 LTSSIDWTIKLWS--LKDTKPLYSFEDNSDYVMDVAWSPVHPALFAAVDGSGRLDLWNL------ 588

  Fly   456 PIRSVDFKVAIADLV-----------FRPEGDLLAIGLKNGDTHIMTLDESMRQATGKEKALMAA 509
               :.|.:|..|.:|           :.|.|..:.||.:.|..::..:.|::.|.:..|    .:
  Fly   589 ---NQDTEVPTASIVVAGAPALNRVSWTPSGLHVCIGDEAGKLYVYDVAENLAQPSRDE----WS 646

  Fly   510 MFEREIVRCKLLEARYDEV 528
            .|...:...|:.::  |||
  Fly   647 RFNTHLSEIKMNQS--DEV 663

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 68/262 (26%)
WD40 211..>488 CDD:225201 75/298 (25%)
WD40 repeat 229..269 CDD:293791 13/41 (32%)
WD40 repeat 277..325 CDD:293791 14/48 (29%)
WD40 repeat 332..369 CDD:293791 8/37 (22%)
WD40 repeat 379..415 CDD:293791 11/42 (26%)
WD40 repeat 422..447 CDD:293791 8/25 (32%)
swNP_477075.2 Dynein_IC2 107..135 CDD:288403
NtpH 228..>298 CDD:225368 17/73 (23%)
WD40 316..632 CDD:295369 83/345 (24%)
WD40 repeat 316..365 CDD:293791 11/59 (19%)
WD40 <344..643 CDD:225201 79/321 (25%)
WD40 repeat 371..409 CDD:293791 11/38 (29%)
WD40 repeat 418..457 CDD:293791 10/43 (23%)
WD40 repeat 469..555 CDD:293791 23/90 (26%)
WD40 repeat 561..599 CDD:293791 13/47 (28%)
WD40 repeat 607..633 CDD:293791 5/26 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C60924170
eggNOG 1 0.900 E1_KOG1587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000393
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12442
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.