DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and dync1i2

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_012825730.1 Gene:dync1i2 XenbaseID:XB-GENE-960812 Length:655 Species:Xenopus tropicalis

Alignment Length:529 Identity:113/530 (21%)
Similarity:198/530 (37%) Gaps:99/530 (19%)


  Fly    23 DRNELMVSVHPS---GRQRLKYIMANPSEKSTQLS---RQMALTVMETENVTLDQHGMYHYEGG- 80
            |.:..::.:|..   ||..:|..|:    |.||:.   |:......||:...|.|..    ||. 
 Frog   136 DTDPSVLQLHSDSDMGRGPIKLGMS----KVTQVDFAPRETVSYTKETQTPILAQDN----EGDE 192

  Fly    81 ------WPKEVNFNDEEQTQRHRKKVE-----------REDSWGEQVLSMIRTTMSVAEQNNTLN 128
                  .||.|...:|::.::..:|.|           ::....|:.:|....:..:.|:  .|:
 Frog   193 DEEETVAPKAVAIQEEDKPEKKEEKTEAPPHELTEEEKQQIIHSEEFVSFFDHSTRIVER--ALS 255

  Fly   129 IYQNFFADLPPELGHDI-----------KMRFRARVANVFHDLWLPARQLRSIEWMPNNSRQFMT 182
            .:.|.|.|..   |.|:           |:.|..:   .|.:.|...|.:..::|........:.
 Frog   256 EHVNIFFDYS---GRDLEEKEGEIQAGAKLSFNRQ---FFDERWSKHRVVSCLDWSSQYPELLVA 314

  Fly   183 QYTNHFAKGERLRPVTDEPFGGTNGFYVWDVK-NPLKPRITYDSKQQVSLAKICPKDENNMVGGT 246
            .|.|:          .|.|........||::| ..:.|...:..:..|..|.......|.:||||
 Frog   315 SYNNN----------EDAPHEPDGVALVWNMKYKKMTPEYVFHCQSAVMSAAFARFHPNLVVGGT 369

  Fly   247 GLGQVCLWGTFKG-GLPIRNCPLE-VSHRETTSALCWVHSKSNTEFYSGSLDGSIKYWDTRDLKM 309
            ..||:.||..... ..|::..||. .:|......:..|.:::.....|.|.||.|..|....|..
 Frog   370 YSGQIVLWDNRSNKRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLISISTDGKICSWSLDMLSQ 434

  Fly   310 PMQELLLEPEPQERQSRMDSHGVTVLEFEYTIPVRFIIGSDMGHVFV----GNRKGMTPMETLLA 370
            |...:    |...:||:  :..||.:.|.......|::||:.|.|:.    |::.|::.|     
 Frog   435 PQDSM----ELVHKQSK--AVAVTCMSFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEM----- 488

  Fly   371 HYQLFVGPVRSIN----------RNPFFVKNFLVTGDWRARIWSEEVKDSPSTMYFRKNAQILCG 425
             ::...||:..|:          .:.|...:|    ||..::|:  .|::.....|..|:..:..
 Frog   489 -FEGHQGPITGIHCHSAVGAVDFSHLFVTSSF----DWTVKLWT--TKNNKPLYSFEDNSDYVYD 546

  Fly   426 A-WSTGRCSLFVTGDINGVVDFWDLLLHHRKPIRS--VDFKVAIADLVFRPEGDLLAIGLKNGDT 487
            . ||....:||...|..|.:|.|:|......|..|  |:...|:..:.:...|..:|:|...|:.
 Frog   547 VMWSPTHPALFACVDGVGRLDLWNLNNDTEVPTASITVEGNPALNRVRWTHSGREIAVGNSEGEI 611

  Fly   488 HIMTLDESM 496
            .|..:.|.:
 Frog   612 FIYDVGEQI 620

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 65/272 (24%)
WD40 211..>488 CDD:225201 69/297 (23%)
WD40 repeat 229..269 CDD:293791 14/41 (34%)
WD40 repeat 277..325 CDD:293791 11/48 (23%)
WD40 repeat 332..369 CDD:293791 11/41 (27%)
WD40 repeat 379..415 CDD:293791 7/46 (15%)
WD40 repeat 422..447 CDD:293791 7/26 (27%)
dync1i2XP_012825730.1 Dynein_IC2 154..182 CDD:288403 8/32 (25%)
WD40 repeat 299..346 CDD:293791 9/57 (16%)
WD40 372..>616 CDD:225201 60/262 (23%)
WD40 397..>622 CDD:295369 54/243 (22%)
WD40 repeat 451..498 CDD:293791 13/53 (25%)
WD40 repeat 506..538 CDD:293791 7/38 (18%)
WD40 repeat 544..582 CDD:293791 11/38 (29%)
WD40 repeat 590..616 CDD:293791 5/26 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000393
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.