DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and CG14838

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_648138.1 Gene:CG14838 FlyBaseID:FBgn0035799 Length:1132 Species:Drosophila melanogaster

Alignment Length:895 Identity:152/896 (17%)
Similarity:281/896 (31%) Gaps:316/896 (35%)


  Fly    11 ERRRFGRQCRFQDR--------NELMVSVHPSGRQRLK-----------YIMANPSE-----KST 51
            ||.|..|:.|.:.|        .|:.:.|     :|.|           |.:..|..     :.|
  Fly   183 ERWRMQRRLRKKPRRWVSHGTDEEMTIMV-----ERFKDEPIDVEIQSVYPIQMPRHVAFDYRMT 242

  Fly    52 QLSRQMALTVMETENVTLDQHGMYHYEGGWPKEVNFNDEEQTQRHRKKVERE---------DSWG 107
            :..|...|.::..||:        .:|....|.||.:    .|....|:|||         ::|.
  Fly   243 RDVRDGVLELLPNENI--------KWENVTKKRVNVS----VQSAPPKIEREQQTNPTFPSNAWS 295

  Fly   108 EQV-------LSMIRTTMSVAEQNNTLNIYQNFFAD---LPPELGHDIKMRFRARVAN---VFHD 159
            :.:       |.:..|.:...|:..........:.:   .|||:...|:|.......|   .:.|
  Fly   296 QYLYEIDDEDLELDETDVDEEEEKKKAQAKPGTYVEPEKKPPEMSAQIEMLLNTLEFNQIDSYRD 360

  Fly   160 LW--LPARQ-------------------------LRSIEWMPNNSRQFMTQYTNHFAKGERLRPV 197
            .:  :.:||                         :...:|.|..|......|.  |:....:...
  Fly   361 DYSLISSRQVVQYTNPYLQEFLCFANISKSNKRFVAGYDWYPKLSGLIAVSYA--FSTPATVNEA 423

  Fly   198 TD----------EPFGGTNGFYVWDVKNPLKPRITYDSKQQVSLAKICPKDENNMVGGTGLGQVC 252
            |:          ||    |...:|...:.|..::.:::..:.:....||.:.:.::||:..|||.
  Fly   424 TNRVDYVQRAVLEP----NPVLLWSFSDNLNYKLEFEAPIETTALTFCPFNGDILLGGSKNGQVV 484

  Fly   253 LW--------------------------GTFKGG---------LPIRNCPLEVSHRETTSALCWV 282
            ||                          |.|...         :|.....|:.|.:...:|..|:
  Fly   485 LWDLQGRCEKLDEEEYLTAAQAKYRIMIGEFLNWTIDIEDNVIVPATISLLDCSPKGAITAFYWL 549

  Fly   283 --------------------HSKSNTEFYSGSLDGSIKYWDT-----RDLKMPMQELLLEPEPQE 322
                                |.|.   |.:.:.||:|.:||.     :..|..|:..:|..|..:
  Fly   550 GRSIYLSQFGKVYNDPDIRNHHKF---FVTCAFDGTISFWDLDGKGGKSAKDKMRNRMLPKELTQ 611

  Fly   323 RQSRMDSHGV------------------------------------------TVLEFEYTIPVRF 345
            .:|...|..:                                          |:.:...|:....
  Fly   612 SESAFKSMVIKPTYNLYFPEPITGIIADTSCLSCLTPVAKLIQANPSNYPIKTIAKDPPTMRQSM 676

  Fly   346 IIGSDMGHVFVGNRKG-------MTPMETLLAHYQLFVGPVRSINRNPFFVKNFLVTGDWRARIW 403
            |:.:..|||...:.:|       ...:.:.:....:..|||..:.:|||:.:.|...|.....||
  Fly   677 IVSTFYGHVSRIDWQGTYTEGEATEVINSSIPFAMVHDGPVVMVKKNPFYPELFASIGRTILAIW 741

  Fly   404 SEEVKDSPSTMYFRKNA-QILCGAWSTGRCSLFVTGDINGVVDFWDLLLHHRKPIRSVDFKVAIA 467
            .|:...||  :::||.| .:...|||..|.::.....|:|:::.||:|..        |....:.
  Fly   742 KEDYNYSP--IFWRKRACDLTAVAWSETRPAVLYLTRIDGILEAWDILAR--------DDDACLT 796

  Fly   468 DLV----------FRPE--GDLLAIGLKNGDTHIM------------TLDESMRQATGKEKALMA 508
            :::          .||.  ..:|.||..|....::            .||:.::....:|:..|.
  Fly   797 EILGGGIITAITEHRPSLPHKILGIGDYNSSIRMVKLPHSFDVPLPNELDQLIKYVLKEERRKMG 861

  Fly   509 AMFEREIVRCKLLEARYDEVRLKRKTLQ--MAEEERVRKQQQLAPTLELDPDNPDQFVMMIEGDE 571
            .....:    |..|...|.:..||:...  ..|.|:..|::|||...:......|..    ||.|
  Fly   862 IQSWEQ----KYYELNKDIIEAKREAAAEIRKEMEKKEKEEQLASRKKGQKSGEDGG----EGGE 918

  Fly   572 EFR--------------------TAITEFQDIILSVERKRSKRQVIMERTVFEE----WNPADEK 612
            |.:                    ..:.....|::|  ||:...:.:...|..|:    :..|.:|
  Fly   919 EIKGKKNYSGLNYNEKMAVKWDELNLNRMMTILMS--RKQMDPEKLARETALEKERHAYEAAKKK 981

  Fly   613 ---------------------------LQGEPVVYTKPERKVQTSGNYDK 635
                                       :|...::..:.:|:|:.:.:|:|
  Fly   982 SHLDILATVENDIANIRSRILPLELQDMQRSEMIAERVKREVENADSYEK 1031

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 65/362 (18%)
WD40 211..>488 CDD:225201 71/399 (18%)
WD40 repeat 229..269 CDD:293791 13/75 (17%)
WD40 repeat 277..325 CDD:293791 14/73 (19%)
WD40 repeat 332..369 CDD:293791 7/86 (8%)
WD40 repeat 379..415 CDD:293791 11/36 (31%)
WD40 repeat 422..447 CDD:293791 6/25 (24%)
CG14838NP_648138.1 WD40 328..>599 CDD:225201 45/280 (16%)
WD40 repeat 462..505 CDD:293791 9/43 (21%)
WD40 repeat 510..547 CDD:293791 6/37 (16%)
RE_R_Pab1 807..>863 CDD:286594 10/56 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C60843728
eggNOG 1 0.900 E1_KOG1587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12442
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.