DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and Dic61B

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_728477.1 Gene:Dic61B FlyBaseID:FBgn0263988 Length:764 Species:Drosophila melanogaster

Alignment Length:523 Identity:105/524 (20%)
Similarity:181/524 (35%) Gaps:173/524 (33%)


  Fly    87 FNDEEQTQRHRK------KVEREDSWGEQVLSMIRTTMSVAEQNNT----LNIYQNFFADLPPEL 141
            |.|:|......|      ::.|...:...::.|.||..|     ||    |..::||        
  Fly   295 FEDDEAVAEKDKVSSQIERLFRSPEFRNAIMYMGRTLSS-----NTNEAGLRRFRNF-------- 346

  Fly   142 GHDIKMRFRARVANVFHDLWLPARQLRSIEWMPNNSRQFMTQYTNHFAKGERLRPVTDEPFGGTN 206
              |...|:.|....|:                   |...:.:.....:|.|| :.|:|..|..:|
  Fly   347 --DQVERWNAEAEYVY-------------------SMNLLFRLVPEPSKDER-KAVSDIDFCRSN 389

  Fly   207 G----------------------FYVWDVKNPLKPRITYDSKQQVSLAKICPKDENNMVGGTGLG 249
            |                      .::|.:|||.:|...|.....|:.....|          .|.
  Fly   390 GDILAVAYGLYSFSSQHVPTSGSVFLWSIKNPGEPERAYYYDVPVTAINFSP----------FLP 444

  Fly   250 QVCLWGTFKGGLPIR------NCPLEVSHRETTS------ALCWVHSKSNTE-------FYSGSL 295
            .:...|.:.|.:.:|      :.|:.||.|.|:.      |:.|:...|:.:       |.|.|.
  Fly   445 SLLAIGLYDGSVEVRDVSSLQDTPVAVSQRSTSPGSSPVVAIRWIKQVSDDDHETDIDPFLSLSQ 509

  Fly   296 DGSIKYWDTRDLKMP----MQELLLE-----PE-----PQER---QSRMDSHGVTVLEFEYTIPV 343
            |||:..:  |.:|.|    ..:::||     ||     |..|   :|.....|:::........:
  Fly   510 DGSVTRF--RIIKSPFLLGFTQMILERVEGHPEGIFVHPSSRIPCESNRHPQGLSITTHPLHKDI 572

  Fly   344 RFIIGSDMG----------HVFVGNRKGMTPMETLLAHYQLFVGPVRSINRNPFFVKNFLVTG-D 397
            .::: :|.|          |.:         :|.|..|    .|.|..:..:|:..|.||..| |
  Fly   573 YYVL-TDEGCIHKCSINYQHQY---------LEVLRCH----DGGVTVMEFSPWSPKLFLTCGND 623

  Fly   398 WRARIWSE-------EVKDSPSTMYFRKNAQILCGAWSTGRCSLFVTGDIN-GVVDFWDLLLHHR 454
            |..|||.:       |:.|..:.:::.|        ||....::.||  :| ...:.||...:..
  Fly   624 WFVRIWVDGITRPLLELLDEMTPVHWAK--------WSPTHSTIIVT--VNRETANVWDFRRNLL 678

  Fly   455 KPIRSVDFKVAIADLV-FRPEGDLLAIGLKNGDT------------HIM--TLDESMRQATGKEK 504
            :|:.......:...:. |...|..|.||.:.|:|            |..  .|::::.:|.|.:.
  Fly   679 RPMSKHKMDSSFNTVARFSHCGRTLVIGNERGNTLFNALNDMPFSPHFQYDELEKAIFKAIGNDH 743

  Fly   505 ALM 507
            .|:
  Fly   744 ELL 746

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 66/307 (21%)
WD40 211..>488 CDD:225201 73/345 (21%)
WD40 repeat 229..269 CDD:293791 7/46 (15%)
WD40 repeat 277..325 CDD:293791 18/78 (23%)
WD40 repeat 332..369 CDD:293791 5/47 (11%)
WD40 repeat 379..415 CDD:293791 13/44 (30%)
WD40 repeat 422..447 CDD:293791 5/26 (19%)
Dic61BNP_728477.1 WD40 358..730 CDD:225201 84/428 (20%)
WD40 repeat 381..429 CDD:293791 10/48 (21%)
WD40 433..711 CDD:295369 66/314 (21%)
WD40 repeat 434..473 CDD:293791 9/49 (18%)
WD40 repeat 552..599 CDD:293791 7/57 (12%)
WD40 repeat 604..637 CDD:293791 11/33 (33%)
WD40 repeat 645..682 CDD:293791 9/47 (19%)
WD40 repeat 691..727 CDD:293791 8/36 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C60888887
eggNOG 1 0.900 E1_KOG1587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12442
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.