DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and Dnai2

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001007727.1 Gene:Dnai2 RGDID:1359602 Length:619 Species:Rattus norvegicus

Alignment Length:650 Identity:200/650 (31%)
Similarity:327/650 (50%) Gaps:68/650 (10%)


  Fly     6 FIYSRERRRFGRQCRFQDRN-ELMVSVHPSGRQRLKYIMANPSEKSTQLSRQMALTVMETENVTL 69
            ::|.::|..||:||.|.||. ||.:.:.|:......|:..||.:...|.|..|:.....||...:
  Rat     5 YVYVKKRSEFGKQCNFSDRQAELNIDISPNPELAALYVERNPVDTGIQCSASMSEHEANTERFEM 69

  Fly    70 DQHGMYHYEGGWPKEVNFNDEEQTQRHRKKVEREDSWGEQVLSMIRTTMSVAEQNNTLNIYQNFF 134
            :..|:.|.||||||:||..:.|||.|.|||||:::::...|:.:........:|||.::||:.:|
  Rat    70 ENCGVNHVEGGWPKDVNPQELEQTIRFRKKVEKDENYINAVMQLGSIMEHCIKQNNAIDIYEEYF 134

  Fly   135 ADLPPELGHDIKMRFRARVANVFHDLWLPARQLRSIEWMPNNSRQFMTQYT-NHFAKGERLRPVT 198
            .|  .|.....:....|:..|||.|.....|....:.|.|:.:::....|: ..|.:        
  Rat   135 DD--EEAVEVTEEAPSAKTINVFRDPQEIKRTATHLSWHPDGNKKLAVAYSCLQFQR-------- 189

  Fly   199 DEPFGGTNGFYVWDVKNPLKPRITYDSKQQVSLAKICPKDENNMVGGTGLGQVCLWGTFKGGLPI 263
             .|.|.::..|:||::||.:|.|.......:...:..|||.:.::||...||:..|.|.||.|..
  Rat   190 -SPMGMSHDSYIWDLENPNRPEIALKPSSPLITLEYNPKDSHVLLGGCYNGQIACWDTRKGSLVA 253

  Fly   264 RNCPLEVSHRETTSALCWVHSKSNTEFYSGSLDGSIKYWDTRDLKMPMQELLLEPEPQERQSRMD 328
            ....:|.|||:......|:.||:.||.:|.|.||.:.:||.|.:..|.:.::::...:|:..  :
  Rat   254 ELSTIEFSHRDPVYGTIWLQSKTGTECFSASTDGQVMWWDIRKISEPTEVVIMDITRKEQLE--N 316

  Fly   329 SHGVTVLEFEYTIPVRFIIGSDMGHVFVGNRKGMTPMETLLAHYQLFVGPVRSINRNPFFVKNFL 393
            :.|...||||.|:|.:|::|::.|.|...|||..||.|.::..:....||:.::.||||:.||||
  Rat   317 ALGAISLEFESTLPTKFMVGTEQGIVISCNRKAKTPAEKIVCTFSGHHGPIYALQRNPFYPKNFL 381

  Fly   394 VTGDWRARIWSEEVKDSPSTMYFRKN-AQILCGAWSTGRCSLFVTGDINGVVDFWDLLLHHRKPI 457
            ..|||.|||||||.::| |.|:.|.: |.:..||||..|.::|.|..::|.:|.|||:.....|.
  Rat   382 TVGDWAARIWSEESRES-SIMWTRYHMAYLSDGAWSPVRPAVFFTTKMDGTLDIWDLVFKQCDPA 445

  Fly   458 RSVD------FKVAIADLVFRPEGDLLAIGLKNGDTHIMTLDESMRQATGKEKALMAAMFEREIV 516
            .|:.      |.:.:.|     .|.|:|.|.:.|.|.::.:..|:......|:.:.:::||||..
  Rat   446 LSLKVCDDPLFCLRVQD-----TGCLIACGSELGTTTLLEVSSSLSTLQRNERNIASSIFERETR 505

  Fly   517 RCKLLEARYDEVRLKRKTLQMAEEERVRKQQQLAPTLELDPDNPDQFVMMIEGDEEFRTAITEFQ 581
            |.|:||||:.|:|||.|.   ..|.|...|::....|:||.       ::.:.:|||      |:
  Rat   506 REKILEARHREMRLKEKG---KAEGRDDDQKEEETALDLDE-------LVNKAEEEF------FE 554

  Fly   582 DIILSVERKRSKRQVIMERTVFEEWNPADEKLQGEPVVYTKPER-KVQTSGNYD-KRTSGEPRAS 644
            .|...::||.:                  |.|:.:|    ||:: .::..|..: :..:||...|
  Rat   555 VIFAELKRKEA------------------EALKKKP----KPKKASIEVEGEDELEDIAGEEEES 597

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 92/259 (36%)
WD40 211..>488 CDD:225201 100/284 (35%)
WD40 repeat 229..269 CDD:293791 12/40 (30%)
WD40 repeat 277..325 CDD:293791 14/48 (29%)
WD40 repeat 332..369 CDD:293791 16/37 (43%)
WD40 repeat 379..415 CDD:293791 21/36 (58%)
WD40 repeat 422..447 CDD:293791 9/25 (36%)
Dnai2NP_001007727.1 WD40 repeat 165..212 CDD:293791 13/56 (23%)
WD40 <166..489 CDD:225201 108/340 (32%)
WD40 166..472 CDD:295369 105/323 (33%)
WD 1 214..254 12/40 (30%)
WD40 repeat 220..259 CDD:293791 12/39 (31%)
WD 2 261..302 16/41 (39%)
WD40 repeat 266..361 CDD:293791 31/97 (32%)
WD40 repeat 318..347 CDD:293791 12/29 (41%)
WD 3 362..401 22/40 (55%)
WD40 repeat 367..403 CDD:293791 21/37 (57%)
WD 4 405..445 14/40 (35%)
WD40 repeat 410..435 CDD:293791 9/25 (36%)
WD 5 450..489 9/44 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D217312at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12442
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.