DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and Wdr34

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001005542.2 Gene:Wdr34 RGDID:1359465 Length:537 Species:Rattus norvegicus

Alignment Length:509 Identity:112/510 (22%)
Similarity:184/510 (36%) Gaps:120/510 (24%)


  Fly    11 ERRRFGRQCRFQDRNELMVSVHPSGRQRLKYIMANP----------SEKSTQLSRQMALTVMETE 65
            |||  ||....||....:.|| ||..:.::.|...|          :|.|.| :|..|...::||
  Rat    30 ERR--GRPAPLQDETLGVASV-PSQWRSVQGIRGEPKSCQTAGIATAEASAQ-ARTHADAQVQTE 90

  Fly    66 NVTLDQHGMYHYEGGWPKE------VNFNDEEQTQRHRKKVEREDSWGEQVLSMIRTTMSVAEQN 124
            .               |:|      |:..|..:.....::||               .|.|.|.|
  Rat    91 A---------------PEEPAAVAPVSQYDTLRLAAFLRRVE---------------AMVVRELN 125

  Fly   125 NTLNIYQNFFADLPPELGHDIKMRFRARVANVFHDLWLPARQ-----LRSIEWMPNNSRQFMTQY 184
            |.   :|:...|     |:::....:.:..:..|.|..|..|     :..|.|  |.:...:.  
  Rat   126 NN---WQSHAFD-----GYEVNWTEQQQTVSCLHTLGYPPAQGQGLHVTGISW--NTTGSVLA-- 178

  Fly   185 TNHFAKGERLRPVTDEPFGGTNGFYV--WDVK----NPLKPRITYDSKQQVSLAKICPKDENNMV 243
               .|.| ||    |:...||...||  |::.    ||.:|.:..:....|......|...:::.
  Rat   179 ---CAYG-RL----DDGDWGTLKSYVCTWNLDRQGLNPHQPSVVVEVPSAVMCLAFHPIQPSHIA 235

  Fly   244 GGTGLGQVCLWGTFKGGLPI--RNCPLEVSHRETTSALCWV----HSKSNTEFYSGSLDGSIKYW 302
            ||...|:|.:|...:...|:  |....:.:|.:....:.|:    || ...:..|.:.||.:..|
  Rat   236 GGLYSGEVLVWDMSRPEDPLLWRTGLTDDTHTDPVYQVLWLPEPRHS-HRFQVLSAATDGRVLLW 299

  Fly   303 D---------TRDLKMPMQEL-----LLEPEPQERQSRMDSHGVTVLEFEYTIPVRFIIGSDMGH 353
            .         ::...:.:|:|     |.:|...|.:.     |||.:.|.......|::|::.|.
  Rat   300 RGSGAGQLRLSKGFALAVQQLPRSTKLKKPPRGETEV-----GVTSVAFSSFDSSLFVLGTEGGF 359

  Fly   354 ----VFVGNRKGMTPMET---LLAHYQLFV----GPVRSINRNPFFVKNFLVTG-DWRARIWSEE 406
                ........:|.|.:   |.|..|...    |||.|::.:||....||..| |....::| .
  Rat   360 PLKCSLAAEAAALTRMPSSVPLRAPVQFTFSPHGGPVYSVSCSPFHRNLFLSAGTDGHVHLYS-M 423

  Fly   407 VKDSPSTMYFRKNAQILCGAWSTGRCSLFVTGDINGVVDFWDLLLHHRKPIRSV 460
            ::..|.|.....:..:....||..|..:|......|.|..:||....:||..|:
  Rat   424 LQAQPLTSLQLSHKYLFAVRWSPVRPLVFAAASGEGDVQLFDLQKSSQKPTVSI 477

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 63/290 (22%)
WD40 211..>488 CDD:225201 62/287 (22%)
WD40 repeat 229..269 CDD:293791 9/42 (21%)
WD40 repeat 277..325 CDD:293791 12/66 (18%)
WD40 repeat 332..369 CDD:293791 9/44 (20%)
WD40 repeat 379..415 CDD:293791 11/37 (30%)
WD40 repeat 422..447 CDD:293791 6/25 (24%)
Wdr34NP_001005542.2 WD40 101..515 CDD:225201 90/420 (21%)
WD40 repeat 165..211 CDD:293791 15/58 (26%)
WD40 218..515 CDD:295369 58/268 (22%)
WD40 repeat 223..265 CDD:293791 8/42 (19%)
WD40 repeat 271..309 CDD:293791 7/39 (18%)
WD40 repeat 339..389 CDD:293791 10/50 (20%)
WD40 repeat 396..433 CDD:293791 11/38 (29%)
WD40 repeat 439..479 CDD:293791 11/40 (28%)
WD40 repeat 486..511 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.