DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and Wdr63

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001128208.1 Gene:Wdr63 RGDID:1563105 Length:921 Species:Rattus norvegicus

Alignment Length:744 Identity:149/745 (20%)
Similarity:256/745 (34%) Gaps:231/745 (31%)


  Fly     6 FIYSRERRRFGRQCRFQDRNELMVSVHPSGRQRLKYI-MANPSEKS---TQLSRQMALTVM---- 62
            ::.||:|.:||....|:|:|...|        :..|| ..:..:||   ||:.:.:.|.|:    
  Rat   186 YMISRKRSQFGAPVTFRDQNASSV--------KDAYIECTSYPDKSYTLTQVEKDIGLQVIAEVK 242

  Fly    63 ETENVT---LDQHGMYHYEGGWPKEVNFNDEEQTQRHRKKVEREDSWGEQVLSMIRTTMSVA-EQ 123
            :|...|   ..::....|   :|:|  |::||      |.|..|.....:..|.:.|::.:| :|
  Rat   243 DTSTQTRWAFPRNATTQY---YPRE--FSEEE------KNVLVESKSLAEFFSTVSTSVEIALQQ 296

  Fly   124 NNTLNIYQNFFADLPPE---LGHDIKMRFRARVANVFHDLW-LPARQLRSIEWMPNNSRQFMTQY 184
            |..:|.:.:.:..|..|   .|.  |.....:....|.||. ...:.:..:.|.|......:...
  Rat   297 NEIMNTFTDDWRSLAEEESTFGD--KTDTHLKEYQSFTDLHNTMEKMITCVSWHPTIYGLIVVSV 359

  Fly   185 TNHFAKGER--------LRPVTDEPFGGTNGFYVWDVKNPLKPRITYDSKQQVSLAKICPKDENN 241
            ....:..||        |:|         :....|...:|:.|::..:|...:...:.||.|.|.
  Rat   360 AVRLSYEERVQNSSRLLLQP---------SLILFWSFSDPIHPQLMLESPDDIFCFEFCPSDPNI 415

  Fly   242 MVGGTGLGQVCLWG---------TFKGG-----------------------LPIRNC---PLEVS 271
            :.||...||:.||.         ..|.|                       :.:|:|   .:|..
  Rat   416 IAGGCINGQIILWDITAHAERIENIKTGGSRSKKATLKPMFLLEPDSNKEIMYVRHCAVSSIENG 480

  Fly   272 HRETTSALCWV---------------HSKSNTEFYSGSLDGSIKYWDTRDLK------------- 308
            ||:..:.:.|:               .|..|.:..:.|.|.:|.:||.|..|             
  Rat   481 HRKVITDIHWLPDSFEINRMGSVFENRSGINCQLITCSADCTICFWDIRPQKPTVTSAATATTTS 545

  Fly   309 ----MPMQELLLEPEPQERQSRMD------------------------SHGVTVLEFEYTIPVRF 345
                .|.|    .|..::::..::                        |.|.|.|:.   .|.:.
  Rat   546 TTNTNPQQ----PPAEKKKEESIEIPFDVPSTFLHLDLSWKPLSRIKLSKGETSLDH---CPTKL 603

  Fly   346 IIGSDMG----------HV------------------------------------------FVGN 358
            .:|.|..          ||                                          |||.
  Rat   604 SLGEDPALCKIQGTSSIHVLLRDKMLSQMKLLKAAEINPYQNLEGGMANMLKPIEDFRTKFFVGT 668

  Fly   359 RKGMT-----PME------TLLAH-----YQLFVGPVRSINRNPFFVKNFLVTGDWRARIWSEEV 407
            .:|..     .||      .|:|.     |.:..|.|.::.|:|||....|..|.|...||.|||
  Rat   669 EEGEVIYTDWKMERDSETGRLMAKKPVNLYTVHDGAVHTVQRSPFFNDIILTVGGWNVAIWKEEV 733

  Fly   408 KDSPSTMYFRKNAQILCGAWSTGRCSLFVTGDINGVVDFWDLLLHHRKPIRSVDFKVAIADLV-- 470
            ...|.........:...|.||..|..:|..|..:|.||.||||....:|.:|....:.:...:  
  Rat   734 LTGPLLQTCCAPKRYTAGHWSLTRPGVFYIGREDGYVDIWDLLEKTHEPAQSQSICITMITYIKP 798

  Fly   471 --FRPEGDLLAIGLKNGDTHIMTLDESMRQATGKEKALMAAMFEREIVRCKLLEARYDEVRLKRK 533
              |..:...:||....|..||:.:..::...:..|.:.:...||||:...:.::.| .|:|.:.|
  Rat   799 WTFSSKQQFIAIADYYGTLHILEIPWTLSHPSTNEVSSVNYYFEREVKHLEYVQQR-KEIREEEK 862

  Fly   534 ---TLQMAEEERV---RKQQQLAPTLELD 556
               .::|.:::..   |.::|:...|:|:
  Rat   863 KAMAMEMIKKKAKTYHRSKEQMEAELKLE 891

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 82/411 (20%)
WD40 211..>488 CDD:225201 86/440 (20%)
WD40 repeat 229..269 CDD:293791 14/75 (19%)
WD40 repeat 277..325 CDD:293791 13/80 (16%)
WD40 repeat 332..369 CDD:293791 14/100 (14%)
WD40 repeat 379..415 CDD:293791 14/36 (39%)
WD40 repeat 422..447 CDD:293791 9/25 (36%)
Wdr63NP_001128208.1 WD40 207..>532 CDD:225201 69/355 (19%)
WD40 479..527 CDD:197651 9/48 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.