DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and Sdic4

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001285485.2 Gene:Sdic4 FlyBaseID:FBgn0053499 Length:487 Species:Drosophila melanogaster

Alignment Length:337 Identity:82/338 (24%)
Similarity:134/338 (40%) Gaps:48/338 (14%)


  Fly    83 KEVNFNDEEQTQ------RHRKKVEREDSWGEQVLSMIRTTMSVAEQNNTLNIYQNFFADLPPEL 141
            ||||...|||.|      ..::.|.|.....|:.||            ..::||.::......|.
  Fly   120 KEVNELSEEQKQMIILSENFQRFVVRAGRVIERALS------------ENVDIYTDYIGGGDSEE 172

  Fly   142 GHDIKMRFRARVANVFHD-LWLPARQLRSIEWMPNNSRQFMTQYTNHFAKGERLRPVTDEPFGGT 205
            .:|.:...|..:..||:| .|...|.:.|::|..:.....:..|.|:       ....:||.|..
  Fly   173 ANDERSHARLSLNRVFYDERWSKNRCITSMDWSTHFPELVVGSYHNN-------EESPNEPDGVV 230

  Fly   206 NGFYVWDVK-NPLKPRITYDSKQQVSLAKICPKDENNMVGGTGLGQVCLW-GTFKGGLPIRNCPL 268
               .||:.| ....|...:..:..|........:.|.::|||..||:.|| ...:...||:..||
  Fly   231 ---MVWNTKFKKSTPEDVFHCQSAVMSTCFAKFNPNLILGGTYSGQIVLWDNRVQKRTPIQRTPL 292

  Fly   269 E-VSHRETTSALCWVHSKSNTEFYSGSLDGSIKYWDTRDLKMPMQELLLEPEPQERQSRMDSHGV 332
            . .:|......|..|.:::.....|.|.||.:..|....|..|...|    |.|:|||:  :..:
  Fly   293 SAAAHTHPVYCLQMVGTQNAHNVISISSDGKLCSWSLDMLSQPQDTL----ELQQRQSK--AIAI 351

  Fly   333 TVLEFEYTIPVRFIIGSDMGHVFVGNRKGMTPMETLLAHYQLFVGPVRSINR-----NPFFVKNF 392
            |.:.|........::||:.|:|:..:|.|:  ...:...|:..:||:..|:.     :|.|...|
  Fly   352 TSMAFPANEINSLVMGSEDGYVYSASRHGL--RSGVNEVYERHLGPITGISTHYNQLSPDFGHLF 414

  Fly   393 LVTGDWRARIWS 404
            |.:.   .:|||
  Fly   415 LTSS---IKIWS 423

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 52/204 (25%)
WD40 211..>488 CDD:225201 51/203 (25%)
WD40 repeat 229..269 CDD:293791 13/41 (32%)
WD40 repeat 277..325 CDD:293791 14/48 (29%)
WD40 repeat 332..369 CDD:293791 8/37 (22%)
WD40 repeat 379..415 CDD:293791 8/32 (25%)
WD40 repeat 422..447 CDD:293791
Sdic4NP_001285485.2 Dynein_IC2 23..51 CDD:288403
NtpH 111..>181 CDD:225368 17/73 (23%)
WD40 <199..464 CDD:225201 59/247 (24%)
WD40 199..>451 CDD:295369 59/247 (24%)
WD40 repeat 200..245 CDD:293791 11/55 (20%)
WD40 repeat 252..295 CDD:293791 13/43 (30%)
WD40 repeat 301..340 CDD:293791 10/43 (23%)
WD40 repeat 351..374 CDD:293791 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C60914702
eggNOG 1 0.900 E1_KOG1587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000393
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12442
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.