DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and DNAI1

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001268357.1 Gene:DNAI1 HGNCID:2954 Length:703 Species:Homo sapiens

Alignment Length:656 Identity:122/657 (19%)
Similarity:226/657 (34%) Gaps:198/657 (30%)


  Fly    16 GRQCRFQDRNELMVSVHPSGRQRLKYIM--------ANPSEKSTQLSRQ-------MALTVMETE 65
            ||:..::|  ||:...:...::.:|.|.        ..|.|..|:...|       .|..|.|.|
Human   118 GRRQHYRD--ELVAVSYQGSQESVKVISETGNLEEDEEPKELETEPGSQTDVPAAGAAEKVTEEE 180

  Fly    66 NVTLDQHGMYHYEGGWPKE------VNFNDE---------------------------------- 90
            .:|..|          |||      .||::.                                  
Human   181 LMTPKQ----------PKERKLTNQFNFSERASQTYNNPVRDRECQTEPPPRTNFSATANQWEIY 235

  Fly    91 ----EQTQRHRKKVERE------------------DSWGEQVLSMIRTTMSVAEQNNTLNIYQNF 133
                |:.::..|..|:|                  .|...|...:|:.:.:.......:|  ||.
Human   236 DAYVEELEKQEKTKEKEKAKTPVAKKSGKMAMRKLTSMESQTDDLIKLSQAAKIMERMVN--QNT 298

  Fly   134 FADLPPELGH--DIKMRFRARVANVFHDLWL----PARQL--RSIEWMPNNSRQFMTQYTNH-FA 189
            :.|:..:..:  |....:|.:|..:. .||.    .|::|  .::.|.|.....|...|.:: |.
Human   299 YDDIAQDFKYYDDAADEYRDQVGTLL-PLWKFQNDKAKRLSVTALCWNPKYRDLFAVGYGSYDFM 362

  Fly   190 KGERLRPVTDEPFGGTNGFYVWDVKNPLKPRITYDSKQQVSLAKICPKDENNMVGGTGLGQVCL- 253
            |..|            ....::.:|||..|...:.|..                     |.:|| 
Human   363 KQSR------------GMLLLYSLKNPSFPEYMFSSNS---------------------GVMCLD 394

  Fly   254 ----------WGTFKGGLPIRNCPLEVSHRE---TTSALCWVHS-------------KSNTEFYS 292
                      .|.:.|.:.|.|  |:..|.:   .:||....||             ..|..|:|
Human   395 IHVDHPYLVAVGHYDGNVAIYN--LKKPHSQPSFCSSAKSGKHSDPVWQVKWQKDDMDQNLNFFS 457

  Fly   293 GSLDGSIKYWDTRDLKM---PMQELLLEPEPQERQSRMDSHGV---TVLEFEYTIPVRFIIGSDM 351
            .|.||.|..|.....|:   .:.:|.:|....|....:..|.|   |..:|...|...|::|::.
Human   458 VSSDGRIVSWTLVKRKLVHIDVIKLKVEGSTTEVPEGLQLHPVGCGTAFDFHKEIDYMFLVGTEE 522

  Fly   352 GHVFVGNRKGMTP-METLLAHYQLFVGPVRSINRNPFFVKNFL-VTGDWRARIWSEEVKDSPSTM 414
            |.::..::...:. ::|..||..    .|.:::.||:..|.|: .:.||..:||...:| :|..:
Human   523 GKIYKCSKSYSSQFLDTYDAHNM----SVDTVSWNPYHTKVFMSCSSDWTVKIWDHTIK-TPMFI 582

  Fly   415 YFRKNAQILCGAWSTGRCSLFVTGDINGVVDFWDLLLHH-----RKPIRSVDFKVAIADLVFRPE 474
            | ..|:.:...||:....::|.....:|....:||.::.     .:|:.:.  |..:..:.|...
Human   583 Y-DLNSAVGDVAWAPYSSTVFAAVTTDGKAHIFDLAINKYEAICNQPVAAK--KNRLTHVQFNLI 644

  Fly   475 GDLLAIGLKNGDTHIMTLDESMRQATGKEKALMAAMFEREIVRCKLLE-ARYDEVRLKRKTLQMA 538
            ..::.:|...|....:.|..::|:...::|.       :|:.:...:| |:.|      |.|.:.
Human   645 HPIIIVGDDRGHIISLKLSPNLRKMPKEKKG-------QEVQKGPAVEIAKLD------KLLNLV 696

  Fly   539 EEERVR 544
            .|.:::
Human   697 REVKIK 702

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 61/292 (21%)
WD40 211..>488 CDD:225201 65/317 (21%)
WD40 repeat 229..269 CDD:293791 8/51 (16%)
WD40 repeat 277..325 CDD:293791 16/64 (25%)
WD40 repeat 332..369 CDD:293791 8/41 (20%)
WD40 repeat 379..415 CDD:293791 11/37 (30%)
WD40 repeat 422..447 CDD:293791 4/25 (16%)
DNAI1NP_001268357.1 WD40 324..681 CDD:225201 80/408 (20%)
WD 1 324..374 11/63 (17%)
WD40 repeat 339..385 CDD:293791 11/58 (19%)
WD40 <357..615 CDD:295369 61/299 (20%)
WD 2 379..417 9/61 (15%)
WD40 repeat 391..428 CDD:293791 8/39 (21%)
WD 3 426..469 12/43 (28%)
WD40 repeat 439..496 CDD:293791 12/57 (21%)
WD 4 478..530 11/52 (21%)
WD40 repeat 504..541 CDD:293791 7/37 (19%)
WD 5 535..574 12/43 (28%)
WD40 repeat 547..584 CDD:293791 12/39 (31%)
WD 6 578..616 8/39 (21%)
WD40 repeat 589..616 CDD:293791 5/27 (19%)
WD 7 622..662 5/42 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.