DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and SdicA

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001303576.1 Gene:SdicA FlyBaseID:FBgn0283432 Length:533 Species:Drosophila melanogaster

Alignment Length:449 Identity:110/450 (24%)
Similarity:184/450 (41%) Gaps:69/450 (15%)


  Fly    83 KEVNFNDEEQTQ------RHRKKVEREDSWGEQVLSMIRTTMSVAEQNNTLNIYQNFFADLPPEL 141
            ||||...|||.|      ..::.|.|.....|:.||            ..::||.::......|.
  Fly   117 KEVNELSEEQKQMIILSENFQRFVVRAGRVIERALS------------ENVDIYTDYIGGGDSEE 169

  Fly   142 GHDIKMRFRARVANVFHD-LWLPARQLRSIEWMPNNSRQFMTQYTNHFAKGERLRPVTDEPFGGT 205
            .:|.:...|..:..||:| .|...|.:.|::|..:.....:..|.|:       ....:||.|..
  Fly   170 ANDERSHARLSLNRVFYDERWSKNRCITSMDWSTHFPELVVGSYHNN-------EESPNEPDGVV 227

  Fly   206 NGFYVWDVK-NPLKPRITYDSKQQVSLAKICPKDENNMVGGTGLGQVCLW-GTFKGGLPIRNCPL 268
               .||:.| ....|...:..:..|........:.|.::|||..||:.|| ...:...||:..||
  Fly   228 ---MVWNTKFKKSTPEDVFHCQSAVMSTCFAKFNPNLILGGTYSGQIVLWDNRVQKRTPIQRTPL 289

  Fly   269 E-VSHRETTSALCWVHSKSNTEFYSGSLDGSIKYWDTRDLKMPMQELLLEPEPQERQSRMDSHGV 332
            . .:|......|..|.:::.....|.|.||.:..|....|..|...|    |.|:|||:  :..:
  Fly   290 SAAAHTHPVYCLQMVGTQNAHNVISISSDGKLCSWSLDMLSQPQDTL----ELQQRQSK--AIAI 348

  Fly   333 TVLEFEYTIPVRFIIGSDMGHVFVGNRKGMTPMETLLAHYQLFVGPVRSINR-----NPFFVKNF 392
            |.:.|........::||:.|:|:..:|.|:  ...:...|:..:||:..|:.     :|.|...|
  Fly   349 TSMAFPANEINSLVMGSEDGYVYSASRHGL--RSGVNEVYERHLGPITGISTHYNQLSPDFGHLF 411

  Fly   393 LVTG-DWRARIWSEEVKDSPSTMYFRKNAQ-ILCGAWSTGRCSLFVTGDINGVVDFWDLLLHHRK 455
            |.:. ||..::||  :||:.....|..|:. ::..|||....:||...|.:|.:|.|:|      
  Fly   412 LTSSIDWTIKLWS--LKDTKPLYSFEDNSDYVMDVAWSPVHPALFAAVDGSGRLDLWNL------ 468

  Fly   456 PIRSVDFKVAIADLV-----------FRPEGDLLAIGLKNGDTHIMTLDESMRQATGKE 503
               :.|.:|.||.:|           :.|.|..:.||.:.|..::..:.|::.|.:..|
  Fly   469 ---NQDTEVPIASIVVAGAPALNRVSWTPSGLHVCIGDEAGKLYVYDVAENLAQPSRDE 524

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 68/262 (26%)
WD40 211..>488 CDD:225201 76/298 (26%)
WD40 repeat 229..269 CDD:293791 13/41 (32%)
WD40 repeat 277..325 CDD:293791 14/48 (29%)
WD40 repeat 332..369 CDD:293791 8/37 (22%)
WD40 repeat 379..415 CDD:293791 11/42 (26%)
WD40 repeat 422..447 CDD:293791 8/25 (32%)
SdicANP_001303576.1 Dynein_IC2 23..51 CDD:288403
NtpH 108..>178 CDD:225368 17/73 (23%)
WD40 196..512 CDD:295369 84/345 (24%)
WD40 repeat 196..245 CDD:293791 11/59 (19%)
WD40 <224..523 CDD:225201 80/321 (25%)
WD40 repeat 251..289 CDD:293791 11/38 (29%)
WD40 repeat 298..337 CDD:293791 10/43 (23%)
WD40 repeat 349..435 CDD:293791 23/90 (26%)
WD40 repeat 441..479 CDD:293791 14/47 (30%)
WD40 repeat 487..513 CDD:293791 5/26 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C60924006
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.