DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and Wdr60

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_006515843.1 Gene:Wdr60 MGIID:2445085 Length:1033 Species:Mus musculus

Alignment Length:584 Identity:115/585 (20%)
Similarity:185/585 (32%) Gaps:178/585 (30%)


  Fly    25 NELMVSVHPSGRQRLK--YIMANPSEKSTQLSRQMALTVMETENVTLDQHGMYHYEGGWPKEVNF 87
            ||..:.:...|::..|  |:..|    ...:.|.:....:||..|.....|......|..:|.:|
Mouse   491 NEYDMYIRNFGKKNTKQAYVQYN----EDNVERDIQTEDIETREVWTQHPGEGTAVSGGSEEKDF 551

  Fly    88 NDEEQTQRHRKKVEREDSWGEQVLSMIRTTMSVA------------------EQNNTLNIYQNFF 134
            :|.       ..|.:.|:  .::.:.:|....|.                  .|:..|||     
Mouse   552 SDV-------TVVPKIDT--PRLANFLRAACQVVAVLLEEDRLAAGPSWIPRAQDKALNI----- 602

  Fly   135 ADLPPELGHDIKMRFRARVANVFHDLWLPARQLRSIEWMPNNSRQFMTQYTNHFAKGERLRPVTD 199
            :|...:|...                 ||..|.|.:..:..:..|..|..:.|....:...|..|
Mouse   603 SDSSSQLNTS-----------------LPFLQSRKVSCLHASRVQRQTVVSVHDLPEKAFAPSLD 650

  Fly   200 EPFGGTNGFYVWDVKNPLKPRITYDSKQQVSLAKICPKDENNMVGGTGLGQVCLWGTFKGG---- 260
                ..:...|||:..|..|:.....:.:|:.....|.....:..||..|.|.:|...:..    
Mouse   651 ----SRHLLCVWDIWQPSGPQKVLICESKVTCCCFSPLKAFLLFAGTVHGSVVVWDLREDSRIHH 711

  Fly   261 -LPIRNC----------------------PLEVSHRETTSAL---CWVHSKSNTE-------FYS 292
             :.:.||                      ||:......|||.   .:|.|..:|:       |:.
Mouse   712 YVRLSNCFWAFRTPTFSTDGILTSVNHRSPLQAIEPVATSAYKKQSFVLSPFSTQEEMAGLSFHI 776

  Fly   293 GSLD--GSIKYW-----DTRDLKMPMQELLLEP------------EPQERQSRMDSH--GVT--- 333
            .|||  |.:..|     ...|:...|.:|.|.|            :.....|..||.  |.|   
Mouse   777 ASLDETGVLNVWVVVELPKADISGSMSDLGLIPGGRIKLVHSTVIQLGNSLSHKDSELWGSTQTL 841

  Fly   334 VLEFEYTIPVRFIIGSDMG--------------HVFVGNRKGMTPMETLLAHYQLFVGPVRSINR 384
            .::|..:.|..|::|:|||              .||...:.|:.|::            |..|:.
Mouse   842 SVKFLPSDPNHFVVGTDMGLISHSTRQDWRVSPRVFKPEQHGVRPIK------------VNVIDF 894

  Fly   385 NPFFVKNFLV-TGDWRARI-----------WSEEVKDSPSTMYFRKNAQILCGAWSTGRCSLFVT 437
            :||....||. ..|...|:           |.........|..          .||..|.::|:.
Mouse   895 SPFEETVFLAGCSDGSIRLHQLTSERPIMQWDNSTSGHAVTSL----------QWSPTRPAVFLV 949

  Fly   438 GDINGVVDFWDLLLHHRKPIR----SVDFKVAIADLVFRPE---GDLLAIGL--KNGDTHIMTL 492
            .|....:..||||.:...|:.    |.|..||:. :|..||   |..:|:.|  .:|...:..|
Mouse   950 QDDASRIYVWDLLENDLGPVAQQPISPDKLVAMT-IVGEPEKTSGSFVALVLARTSGTVDVQNL 1012

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 71/343 (21%)
WD40 211..>488 CDD:225201 79/373 (21%)
WD40 repeat 229..269 CDD:293791 11/67 (16%)
WD40 repeat 277..325 CDD:293791 16/77 (21%)
WD40 repeat 332..369 CDD:293791 12/54 (22%)
WD40 repeat 379..415 CDD:293791 10/48 (21%)
WD40 repeat 422..447 CDD:293791 5/25 (20%)
Wdr60XP_006515843.1 PRP38_assoc 86..167 CDD:289628
WD40 604..1000 CDD:225201 89/440 (20%)
WD40 repeat 635..671 CDD:293791 8/40 (20%)
WD40 673..961 CDD:295369 61/310 (20%)
WD40 repeat 676..708 CDD:293791 7/32 (22%)
WD40 repeat 715..752 CDD:293791 6/37 (16%)
WD40 repeat 759..788 CDD:293791 8/29 (28%)
WD40 repeat 842..878 CDD:293791 9/36 (25%)
WD40 repeat 890..926 CDD:293791 8/36 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.