DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and DYNC1I2

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001258714.1 Gene:DYNC1I2 HGNCID:2964 Length:638 Species:Homo sapiens

Alignment Length:577 Identity:125/578 (22%)
Similarity:211/578 (37%) Gaps:120/578 (21%)


  Fly    23 DRNELMVSVHPS---GRQRLKYIMANPSEKSTQLS---RQMALTVMETENVTLDQHGMYHYEGGW 81
            |.:..::.:|..   ||..:|..||    |.||:.   |::.....||:...:.|          
Human   117 DTDPSVLQLHSDSDLGRGPIKLGMA----KITQVDFPPREIVTYTKETQTPVMAQ---------- 167

  Fly    82 PKEVNFND----------EEQTQRHRKKVEREDS----------------WGEQVLSMIRTTMSV 120
            |||....|          |.:.::..||.|..||                ..|:.||....:..:
Human   168 PKEDEEEDDDVVAPKPPIEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLSFFDHSTRI 232

  Fly   121 AEQ--NNTLNIYQNFFA-DLPPELGHDIKMRFRARVA---NVFHDLWLPARQLRSIEWMPNNSRQ 179
            .|:  :..:||:.::.. ||..:.|   :::..|:::   ..|.:.|...|.:..::|.......
Human   233 VERALSEQINIFFDYSGRDLEDKEG---EIQAGAKLSLNRQFFDERWSKHRVVSCLDWSSQYPEL 294

  Fly   180 FMTQYTNHFAKGERLRPVTDEPFGGTNGFYVWDVK-NPLKPRITYDSKQQVSLAKICPKDENNMV 243
            .:..|.|:          .|.|........||::| ....|...:..:..|..|.......|.:|
Human   295 LVASYNNN----------EDAPHEPDGVALVWNMKYKKTTPEYVFHCQSAVMSATFAKFHPNLVV 349

  Fly   244 GGTGLGQVCLWGTFKG-GLPIRNCPLE-VSHRETTSALCWVHSKSNTEFYSGSLDGSIKYWDTRD 306
            |||..||:.||..... ..|::..||. .:|......:..|.:::.....|.|.||.|..|....
Human   350 GGTYSGQIVLWDNRSNKRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLISISTDGKICSWSLDM 414

  Fly   307 LKMPMQELLLEPEPQERQSRMDSHGVTVLEFEYTIPVRFIIGSDMGHVFV----GNRKGMTPMET 367
            |..|...:    |...:||:  :..||.:.|.......|::||:.|.|:.    |::.|::.|  
Human   415 LSHPQDSM----ELVHKQSK--AVAVTSMSFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEM-- 471

  Fly   368 LLAHYQLFVGPVRSIN----------RNPFFVKNFLVTGDWRARIWSEEVKDSPSTMYFRKNAQI 422
                ::...||:..|:          .:.|...:|    ||..::|:  .|::.....|..||..
Human   472 ----FEGHQGPITGIHCHAAVGAVDFSHLFVTSSF----DWTVKLWT--TKNNKPLYSFEDNADY 526

  Fly   423 LCGA-WSTGRCSLFVTGDINGVVDFWDLLLHHRKPIR--SVDFKVAIADLVFRPEGDLLAIGLKN 484
            :... ||....:||...|..|.:|.|:|......|..  ||:...|:..:.:...|..:|:|...
Human   527 VYDVMWSPTHPALFACVDGMGRLDLWNLNNDTEVPTASISVEGNPALNRVRWTHSGREIAVGDSE 591

  Fly   485 GDTHIMTLDESMRQATGKEKALMAAMFEREIVRCKLLEARYDEVRLKRKTLQMAEEE 541
            |...|..:.|.:......|    .|.|.|.:.          |:...|..   ||||
Human   592 GQIVIYDVGEQIAVPRNDE----WARFGRTLA----------EINANRAD---AEEE 631

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 66/272 (24%)
WD40 211..>488 CDD:225201 70/297 (24%)
WD40 repeat 229..269 CDD:293791 14/41 (34%)
WD40 repeat 277..325 CDD:293791 11/48 (23%)
WD40 repeat 332..369 CDD:293791 11/41 (27%)
WD40 repeat 379..415 CDD:293791 7/46 (15%)
WD40 repeat 422..447 CDD:293791 7/26 (27%)
DYNC1I2NP_001258714.1 Dynein_IC2 135..163 CDD:314442 9/32 (28%)
WD 1 277..326 10/59 (17%)
WD40 repeat 282..331 CDD:293791 9/59 (15%)
WD40 329..>599 CDD:225201 68/288 (24%)
WD 2 330..370 12/40 (30%)
WD40 repeat 339..377 CDD:293791 12/38 (32%)
WD 3 379..420 10/41 (24%)
WD40 repeat 385..426 CDD:293791 10/45 (22%)
WD 4 429..469 11/42 (26%)
WD40 repeat 434..481 CDD:293791 13/53 (25%)
WD 5 474..519 9/51 (18%)
WD40 repeat 489..521 CDD:293791 7/38 (18%)
WD 6 522..562 12/40 (30%)
WD40 repeat 527..565 CDD:293791 10/38 (26%)
WD 7 568..607 7/39 (18%)
WD40 repeat 573..599 CDD:293791 5/26 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000393
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.