DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and dnai2

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_002935429.1 Gene:dnai2 XenbaseID:XB-GENE-854694 Length:587 Species:Xenopus tropicalis

Alignment Length:633 Identity:215/634 (34%)
Similarity:325/634 (51%) Gaps:61/634 (10%)


  Fly     6 FIYSRERRRFGRQCRFQDR-NELMVSVHPSGRQRLKYIMANPSEKSTQLSRQMALTVMETENVTL 69
            ::|:|:|..|||||.|.|| .||.|.:.|...|.|.:|..||.:.:.|.|.:|:...:.||...:
 Frog     5 YVYTRKRSEFGRQCNFSDRPAELHVDILPDPSQALNFIERNPCDVAIQCSHEMSEHEVNTERYEM 69

  Fly    70 DQHGMYHYEGGWPKEVNFNDEEQTQRHRKKVEREDSWGEQVLSMIRTTMSVAE----QNNTLNIY 130
            :..|:.|.||||||::|..:.|||.|.|||||::|.:    ::.|....||.|    |||.:|||
 Frog    70 EARGINHVEGGWPKDINPQEMEQTIRFRKKVEKDDHY----IATISQLGSVMEHCIKQNNAINIY 130

  Fly   131 QNFFADLPPELGHDIKMRFRARVANVFHDLWLPARQLRSIEWMPNNSRQFMTQYT-NHFAKGERL 194
            :.:|.|.....|.|...  .|...|||.|.....|....:.|.|:.||:....|: ..|.:..: 
 Frog   131 EEYFEDTEELEGMDETP--SANTVNVFRDPNEIKRTATHLSWHPDGSRKLAVAYSCLDFQRAPK- 192

  Fly   195 RPVTDEPFGGTNGFYVWDVKNPLKPRITYDSKQQVSLAKICPKDENNMVGGTGLGQVCLWGTFKG 259
                |..:..    |:||::.|.||.:|......:...:..|||.:.:|||...||:..|.|.||
 Frog   193 ----DMSYES----YIWDIEIPNKPELTLKPVSPLVCLEYNPKDSHVLVGGCYNGQIAYWDTRKG 249

  Fly   260 GLPIRNCPLEVSHRETTSALCWVHSKSNTEFYSGSLDGSIKYWDTRDLKMPMQELLLEPEPQERQ 324
            |.|:.:..:|.|||:....:.|:.||:.||.:|.|.||.|.:||.|.|..|.::|:|:...:|..
 Frog   250 GNPMESTVIEHSHRDPVYKVIWLQSKTGTECFSASTDGQILWWDIRKLSEPTEKLILDISKKENL 314

  Fly   325 SRMDSHGVTVLEFEYTIPVRFIIGSDMGHVFVGNRKGMTPMETLLAHYQLFVGPVRSINRNPFFV 389
            .  ::.|...||||.|:|.:|::|::.|.:...|||..||.|.::..|....||:.||.||||:.
 Frog   315 D--NALGAVSLEFEPTLPTKFMVGTEQGMIVSCNRKAKTPPEKIVCTYGGHHGPIYSIQRNPFYP 377

  Fly   390 KNFLVTGDWRARIWSEEVKDSPSTMYFRKNAQILCGA-WSTGRCSLFVTGDINGVVDFWDLLLHH 453
            ||||..|||.||||||:.::| |.|:.:.:...|..| ||..|.::|:|..::|.:|.||.:...
 Frog   378 KNFLTVGDWTARIWSEDCRES-SIMWTKYHMSYLTDACWSPTRPTVFLTTKMDGTLDVWDYMYKQ 441

  Fly   454 RKPIRSVDFKVA---IADLVFRPEGDLLAIGLKNGDTHIMTLDESMRQATGKEKALMAAMFEREI 515
            ..|  |:..||:   :..:..:..|..:|.|.:.|.|.:|.|.:.:......|:.|.:||||||.
 Frog   442 NNP--SLSVKVSGEPLYSIRMQDNGRFVACGSQMGVTTLMELSKGLYTLQRNERNLASAMFERET 504

  Fly   516 VRCKLLEARYDEVRLKRKTLQMAEEERVRKQQQLAPTLELDPDNPDQFVMMIEGDEEFRTAITEF 580
            .|.|:||||:.|:|||.::             :..|..|:..:.|.:     :.:|....|..:|
 Frog   505 KREKILEARHREMRLKERS-------------KAEPGEEVKEEKPAE-----DMNEIIANAEKDF 551

  Fly   581 QDIILSVERKRSKRQVIMERTVFEEWNPADEKLQGEPVVYTKPERKVQ 628
            .:|| ..|.||.::|        |...|.||..:.|    ...|:.||
 Frog   552 FEII-EAELKRKEQQ--------ERKQPEDEHQEKE----VSEEKIVQ 586

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 96/253 (38%)
WD40 211..>488 CDD:225201 103/281 (37%)
WD40 repeat 229..269 CDD:293791 14/40 (35%)
WD40 repeat 277..325 CDD:293791 18/48 (38%)
WD40 repeat 332..369 CDD:293791 15/37 (41%)
WD40 repeat 379..415 CDD:293791 22/36 (61%)
WD40 repeat 422..447 CDD:293791 9/26 (35%)
dnai2XP_002935429.1 WD40 repeat 99..135 CDD:293791 15/40 (38%)
WD40 <166..489 CDD:225201 113/337 (34%)
WD40 repeat 166..215 CDD:293791 14/58 (24%)
WD40 217..471 CDD:295369 95/259 (37%)
WD40 repeat 220..259 CDD:293791 14/39 (36%)
WD40 repeat 267..308 CDD:293791 17/41 (41%)
WD40 repeat 320..361 CDD:293791 16/41 (39%)
WD40 repeat 367..403 CDD:293791 22/37 (59%)
WD40 repeat 410..435 CDD:293791 9/25 (36%)
tolA_full <503..>587 CDD:274303 31/116 (27%)
PTZ00438 <522..>587 CDD:185618 20/97 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C252702404
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D217312at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.710

Return to query results.
Submit another query.