DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and wdr63

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_017209145.2 Gene:wdr63 ZFINID:ZDB-GENE-121116-5 Length:968 Species:Danio rerio

Alignment Length:815 Identity:150/816 (18%)
Similarity:271/816 (33%) Gaps:269/816 (33%)


  Fly    13 RRFGRQCRFQDRNELMVSVHPSGRQRLKYIMANPSEKSTQLSRQMALTVMETENVTLDQHGMYH- 76
            ||.|.:.||.|||.|      ..::.|       .|.|:...:..::|.||.::.|.......| 
Zfish   202 RRSGTRVRFSDRNAL------DWKEEL-------VECSSYEDKSFSITRMERDSSTQTCRDNTHT 253

  Fly    77 -YEGGWPKEVNFNDEEQTQRHRKKVEREDSWGEQVLSMIRTTMSVAEQNNTLNIY--QNFFADL- 137
             .:..|.|..|...:.:.:....:.::.....|.:.:.|   .|||.:   ..||  ||..||: 
Zfish   254 CTQTLWKKPKNMWSQYEPREFSSEEKQHQLQSENLKNFI---TSVARR---FEIYLQQNLIADVF 312

  Fly   138 -----------PPELGHDIKMRFRARVANVFHDL-WLPARQLRSIEWMPNNSRQFMTQYTNHFAK 190
                       ...:|   |...:.:....|.|| :...:.:..::|.|:.|...:.......:.
Zfish   313 CDDWTALCEDDASLMG---KTETQLKEYQSFMDLHFSKEKTISHVQWHPSISGVIVVSMMERLSL 374

  Fly   191 GERLRPVTDEPFGGTNGFYVWDVKNPLKPRITYDSKQQVSLAKICPKDENNMVGGTGLGQVCLW- 254
            .||:...|......::..: |...:|:.|::..:....|...:..|.|.|.:.||...|||.|| 
Zfish   375 EERIDSSTKLLLNPSHILF-WSFSDPINPQLQLECPDDVLCFQFSPSDHNIIAGGCMNGQVVLWD 438

  Fly   255 ---------GTFKGGLPIRN-------------CP---LEVSHRETTSALCWV------------ 282
                     .|..||..|.|             |.   :|..|:...:.:.|:            
Zfish   439 ISAHVDRLQDTRSGGKNILNKLGKSDATPVVRYCAVSGIENGHKAPITDIQWLPETFEVNKLGTP 503

  Fly   283 ---HSKSNTEFYSGSLDGSIKYWDTRDLKMPMQELLLEPEPQERQSRMDSHGV----TVLEF--- 337
               .|:::.:..:.:.|..:.:||.|..::.:..|....:.||.:...:.|||    |.|..   
Zfish   504 VENQSRTSVQLVTCAPDCCVLFWDLRAPRVMVHSLTDIKQKQEEKPLENPHGVPNTFTHLNLTWK 568

  Fly   338 --------------EYTIPVRF---------------IIGSDMGHVFVGNR----KGMTPMETLL 369
                          ||: |:||               :.|:| ..||...|    |...|::.:.
Zfish   569 PFIRVSLPKISSSGEYS-PLRFSMRENTVDYNTGDKSVSGAD-SRVFAQLRMQSAKQQKPLQNIS 631

  Fly   370 AHYQLFVGP------------------------------------VRSINRNPFFVKNFLVTGDW 398
            .  :|::..                                    :.:::|:|||....|..|.:
Zfish   632 T--KLYIATEDGELVYTDWKVEKDNDSGRMLSAKPLDVFLLQDTLLHTVSRSPFFRDIILTVGRF 694

  Fly   399 RARIWSEEVKDSPSTMYFRKNAQILCGAWSTGRCSLFVTGDINGVVDFWDLLLHHRKPIRSVDFK 463
            ...||.|.:...|..|.....:....|.||..|.::...|..:|.|:.||||.:.|:|..:.:..
Zfish   695 SFSIWREGLTCGPLLMSVYSKSMFSAGHWSRSRPAVLFMGREDGDVEVWDLLQNSRQPSHTQNIS 759

  Fly   464 VAI------------------------------ADLVFRP------------------------- 473
            .|.                              |....||                         
Zfish   760 TAAISCIRTQTSSGNTHPYTETLHTHTHTQPPSAAYAHRPAPVTHTHTHKHCTHTHTHTHTHTHT 824

  Fly   474 -----------------------EGDLLAIGLKNGDTHIMTLDESMRQATGKEKALMAAMFEREI 515
                                   :.:|||:..:.|..||:.:..|:|:::..|:..:...||:|.
Zfish   825 HSRHQLHTHTDQLRVLEERVREAKQNLLAVSDRLGTLHILQIPGSLRRSSSSERQNVEKYFEKEE 889

  Fly   516 VRCKLLEARYDEVRLKRKTLQMAEEERVRKQQQLAPTLELDPDNPDQFVMMIEGDEEFRT-AITE 579
            .|.:..|.|..:.:.|:|..: ||::: :|.:.:.|        |.|       :||... .:.|
Zfish   890 ERLQYFEKRQSDHQKKKKETE-AEQQK-KKTELVTP--------PKQ-------EEEVNAETLKE 937

  Fly   580 FQDIILSVERKRSKRQVIMERTVFEEWNPADEKLQ 614
            :|..:            .:|:.:.::.|..:|..|
Zfish   938 YQQFL------------TLEKLILKDMNIQNETQQ 960

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 73/369 (20%)
WD40 211..>488 CDD:225201 81/472 (17%)
WD40 repeat 229..269 CDD:293791 17/66 (26%)
WD40 repeat 277..325 CDD:293791 9/63 (14%)
WD40 repeat 332..369 CDD:293791 15/77 (19%)
WD40 repeat 379..415 CDD:293791 11/36 (31%)
WD40 repeat 422..447 CDD:293791 7/25 (28%)
wdr63XP_017209145.2 WD40 <348..>533 CDD:225201 34/186 (18%)
SMC_N <835..>953 CDD:330553 28/147 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.