DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and wdr78

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:NP_001106504.1 Gene:wdr78 XenbaseID:XB-GENE-5890871 Length:795 Species:Xenopus tropicalis

Alignment Length:575 Identity:108/576 (19%)
Similarity:184/576 (32%) Gaps:161/576 (28%)


  Fly    46 PSEKSTQLSRQMALTVMETENVTLDQHGMY--HYEGGWPKEVNFNDEEQTQRHRKKVEREDSWGE 108
            |..|..|..|    .::|...||.....:|  :|.   |:.:...:........|.:....|   
 Frog   264 PKSKEVQCDR----IILEDIGVTASVWDLYDSYYS---PESLTVKETVDRATESKNISTSRS--- 318

  Fly   109 QVLSMIRTTMSVAEQNNTLNIYQNF-----------FADLPPELGHD------------------ 144
               |..|.|.||    |:|....:|           .|.:|.|...|                  
 Frog   319 ---SESRGTRSV----NSLGRADSFSSSATDIEGLPLARIPDEAEPDSEEILKLEKFQQDLFFME 376

  Fly   145 ---IKMRFRARVA-----------------------NV----FHDLW------LPARQLRSIEWM 173
               ::..|::|:|                       |:    .:.||      .....:.||.|.
 Frog   377 RVVVENTFQSRLAAYRQLPVIADHEEDEDKISAVSSNIMSPSLNRLWSFACDVTKGHNVSSISWN 441

  Fly   174 PNNSRQFMTQYTNHFAKGERLRPVTDEPFGGTNGF--------YVWDVKNPLKPRITYDSKQQVS 230
            ..||......|                   |..||        ..|.:||.:.|...:..:..|:
 Frog   442 KKNSDLLAVGY-------------------GQFGFTEQKGGMACCWSLKNIMWPERIFHCECGVT 487

  Fly   231 LAKICPKDENNMVGGTGLGQVCLWGTFKG-GLPIRNCPLEVS-----HRETTSALCWV-HSKSNT 288
            .........|.:..|...|.|.::..... ..|:    |:.|     |......|.|: |.:.|.
 Frog   488 AVDFSAVHPNLLAVGMYNGTVAIYNVQNNEDFPV----LDSSDNPNKHTSPVWQLKWIEHDRGNL 548

  Fly   289 EFYSGSL------DGSIKYW------DTRDLKMPMQELLLEP------EPQERQSRMDSHGVTVL 335
            ....|.:      ||.|..|      |..|| |.::....|.      |.:::.....|.....:
 Frog   549 GDDKGEILVSVCADGRITRWHIRKGLDCNDL-MKLKRTGSEKSKKSSNEKEKKGEAFISRQAPGM 612

  Fly   336 EFEYTIPVR---FIIGSDMGHVFVGNRKGMTPMETLLAHYQLFVGPVRSINRNPFFVKNFL-VTG 396
            .|:: :|..   ::.|::.||:   ::...:..|..|..|:...|||..|..:||....|| .:.
 Frog   613 CFDF-LPKDSNIYLAGTEEGHI---HKCSCSYNEQFLDTYRGHKGPVYKIAWSPFCPDVFLSCSA 673

  Fly   397 DWRARIWSEEVKDSPSTMYFRKNAQILCGAWSTGRCSLF--VTGDINGVVDFWDLLLHHRKP--I 457
            ||...:|.::|. ||...:......:....||.....:|  ||   ...|:.|||......|  :
 Frog   674 DWCIHLWQQDVL-SPILTFSNTTNAVYDIMWSPSSALMFGAVT---ENRVEIWDLGTSTIDPLIV 734

  Fly   458 RSVDFKVAIADLVFRPEGDLLAIGLKNGDTHIMTLDESMRQATGKEKALMAAMFE 512
            ...:..|.:..::|....:.:.||..:|..::..|    |..:..:.:.:.|:::
 Frog   735 NEANPGVKLTSILFAKNTNCVLIGDSDGQVNVYEL----RNVSSSKDSEVNALYD 785

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 61/285 (21%)
WD40 211..>488 CDD:225201 66/310 (21%)
WD40 repeat 229..269 CDD:293791 7/41 (17%)
WD40 repeat 277..325 CDD:293791 15/67 (22%)
WD40 repeat 332..369 CDD:293791 6/40 (15%)
WD40 repeat 379..415 CDD:293791 12/37 (32%)
WD40 repeat 422..447 CDD:293791 6/27 (22%)
wdr78NP_001106504.1 WD40 359..782 CDD:225201 83/459 (18%)
WD40 431..768 CDD:295369 75/369 (20%)
WD40 repeat 435..480 CDD:293791 13/64 (20%)
WD40 repeat 487..523 CDD:293791 6/40 (15%)
WD40 repeat 613..650 CDD:293791 8/41 (20%)
WD40 repeat 656..693 CDD:293791 11/38 (29%)
WD40 repeat 698..736 CDD:293791 10/41 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.