DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1571 and dync1i1

Sequence 1:NP_572435.1 Gene:CG1571 FlyBaseID:FBgn0029993 Length:651 Species:Drosophila melanogaster
Sequence 2:XP_017945105.1 Gene:dync1i1 XenbaseID:XB-GENE-490874 Length:714 Species:Xenopus tropicalis

Alignment Length:532 Identity:121/533 (23%)
Similarity:198/533 (37%) Gaps:82/533 (15%)


  Fly     9 SRERRRFGRQCRFQDRNELMVSVHPS---GRQRLKYIMANPSEKSTQL------------SRQMA 58
            |.|....||..:: |.:..::.:|..   ||:.:|..::    |.||:            ..|..
 Frog   184 SVEGTLMGRTLQW-DTDPSVLQLHSDSELGRRLIKLGVS----KVTQVDFLPREVVSYSKETQTP 243

  Fly    59 LTVMETENVTLDQHGMYHYEGGWPKEVNFNDEEQTQRH---RKKVERED---SWGEQVLSMIRTT 117
            :|..:||....|:. |...:.....|....:|:|..|.   |:..|.|.   :..|:.|.....|
 Frog   244 VTTHQTEEEEEDEE-MVDLKTEHDSEFENQEEKQDSREVPPRELTEEEKQQVTHSEEFLIFFDRT 307

  Fly   118 MSV-----AEQNNTLNIYQNFFADLPPELGHDIKMRFRARVANVFHD-LWLPARQLRSIEWMPNN 176
            :.|     ||.:|....|..  .||..:.| ||:..........|:| .|...|.:..::|....
 Frog   308 IRVIERALAEDSNIFFDYSG--RDLEDKEG-DIQAGANLSFNRQFYDEHWSKHRVVTCLDWSLQY 369

  Fly   177 SRQFMTQYTNHFAKGERLRPVTDEPFGGTNGFYVWDVK-NPLKPRITY---DSKQQVSLAKICPK 237
            ....:..|.|:          .|.|........||::| ....|...:   .|...|..|:..| 
 Frog   370 PELMVASYNNN----------EDAPHEPDGVALVWNMKFRKTTPEYIFHCQSSVMSVCFARFHP- 423

  Fly   238 DENNMVGGTGLGQVCLW-GTFKGGLPIRNCPLE-VSHRETTSALCWVHSKSNTEFYSGSLDGSIK 300
              |.::|||..||:.|| .......|::..||. .:|......:..|.:::.....:.|.||.:.
 Frog   424 --NLVIGGTYSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPIYCVNVVGTQNAHNLITVSTDGKLC 486

  Fly   301 YWDTRDLKMPMQELLLEPEPQERQSRMDSHGVTVLEFEYTIPVRFIIGSDMGHVFV----GNRKG 361
            .|....|..|.:.:.|.      .::.....||.:.|.......|::||:.|.|:.    |::.|
 Frog   487 SWSLDMLSAPQESMELV------YNKSKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACRHGSKAG 545

  Fly   362 MTPMETLLAHYQLFVGPVRSINRN----PFFVKNFLVTG--DWRARIWSEEVKDSPSTMYFRKNA 420
            ::  |....|.    |||..||.:    |....:..:|.  ||..::|:  .|.:.....|..||
 Frog   546 IS--EVFEGHQ----GPVTGINCHNAVGPIDFSHLFLTSSFDWTVKLWT--TKHNKPLYSFEDNA 602

  Fly   421 QILCG-AWSTGRCSLFVTGDINGVVDFWDLLLHHRKPIRS--VDFKVAIADLVFRPEGDLLAIGL 482
            ..:|. .||....:||...|..|.:|.|:|......|..|  |:...|:..:.:...|..:|:|.
 Frog   603 DYVCDVTWSPVHPALFACVDGMGRLDLWNLNNDTEVPTASTAVEGASALNRVRWAQSGKEVAVGD 667

  Fly   483 KNGDTHIMTLDE 494
            ..|...|..:.|
 Frog   668 SEGRVWIYDVGE 679

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1571NP_572435.1 WD40 210..462 CDD:295369 67/271 (25%)
WD40 211..>488 CDD:225201 71/296 (24%)
WD40 repeat 229..269 CDD:293791 14/41 (34%)
WD40 repeat 277..325 CDD:293791 8/48 (17%)
WD40 repeat 332..369 CDD:293791 11/41 (27%)
WD40 repeat 379..415 CDD:293791 9/42 (21%)
WD40 repeat 422..447 CDD:293791 8/26 (31%)
dync1i1XP_017945105.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000393
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.