DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Upf2 and upf2

DIOPT Version :8

Sequence 1:NP_572434.1 Gene:Upf2 / 31724 FlyBaseID:FBgn0029992 Length:1241 Species:Drosophila melanogaster
Sequence 2:XP_017210611.1 Gene:upf2 / 569006 ZFINID:ZDB-GENE-090715-1 Length:583 Species:Danio rerio

Alignment Length:580 Identity:214/580 - (36%)
Similarity:313/580 - (53%) Gaps:93/580 - (16%)


  Fly   543 QRKKLTRTIFSVQRTRLDILPYLSRFVAIVHMCNTDVATDLAELLRKEFKWHIHKKNQLNIETKL 607
            |.....|.:|:|.|.|||:||:.:|.||.:|.|.:|||.||..:|:.:|::||.||:|:|||||.
Zfish    19 QETLAVRALFTVPRQRLDLLPFYARLVATLHPCMSDVAEDLCSMLKGDFRFHIRKKDQINIETKN 83

  Fly   608 KIVRFIGELVKFGLFKKFDALGCLKMLLRDFQHHQIEMACAFVEVTGVYLYNCRDARLLMNVFLD 672
            |.|||||||.||.:|.|.|.|.|||::|.||.||.|||||..:|..|.:|:...|:.|..:|.|:
Zfish    84 KTVRFIGELAKFKMFSKTDTLHCLKVMLSDFSHHHIEMACTLLETCGRFLFRSPDSHLRTSVLLE 148

  Fly   673 QMLRLKTATAMDSRHAAQIESVYYLVKPPESSKREPMVRPAMHEYIRYLIFEELCKQNVDRCIKM 737
            ||:|.|.|..:|.|:...:|:.||...||...|.....||.:.||||.|::::|.|...::.::.
Zfish   149 QMMRKKQAQHLDVRYVTMVENAYYYCNPPPMEKTVRRKRPPLQEYIRKLLYKDLSKVTTEKVLRQ 213

  Fly   738 LRRIDWQDPETNCYAIKCLSKAYLLRFQLIRCLADLVSGLSSYQPRAVTIVIDNVFEDIRAGLEI 802
            :|::.|.|.|...|.|.|:...:.:::..|.|:|:|::||.:||......|:|.|.||||.|:|:
Zfish   214 MRKLPWHDSEVKGYLICCMVNIWNVKYNSIXCVANLLAGLVAYQEDVGIHVVDGVLEDIRLGMEV 278

  Fly   803 HSPRMAQRRIAMAKYLGEMYNYKLVESTNILNTLYSIISLGVSNDQNVVSPLDPPDSLFRLKLAC 867
            :.|:..||||:.||:|||:|||::|||..|..||:|.||.||:.| ...||||||:.|||:::.|
Zfish   279 NQPKFNQRRISSAKFLGELYNYRMVESAVIFRTLFSFISFGVNTD-GTASPLDPPEHLFRIRMVC 342

  Fly   868 MLLDTCAPYFTSQATRKKLDYFLVFFQHYYWFKKSHPVFSKTENTSDLFPILMDHTYRDCLLNVR 932
            .|||||..||...:::||||.||::||.|.|:|||..|::|.:.    |||.:::...|.|..:|
Zfish   343 TLLDTCGQYFDRGSSKKKLDCFLIYFQRYIWWKKSLDVWTKDQP----FPIDIEYMITDTLEMLR 403

  Fly   933 PKLKI---------------YKSLEQAKAAIDHLQEKLYPQLKTTNNAQDPSLGTISEISE---- 978
            ||:|:               ..||...|..::            .:.....|||....:.|    
Zfish   404 PKMKLCSLWRRPALTSACWRESSLSNWKRGLE------------KDGRSSSSLGESEALDEEDDD 456

  Fly   979 -IDEGG--TDEDS------------------GSSNDQRERQVSGQEQDQSNDW-----TENE--- 1014
             .||||  |:|.|                  ||.|::.||    :|::::.|:     .|||   
Zfish   457 DEDEGGAETEEQSGNESEMNEPEEEVNIITEGSENEEEER----EEEEENTDYLTDSNKENETDE 517

  Fly  1015 -----------------AEPPLPPLP-----PPEKSKEDLEFEQ--LYEKMTTDSYQERL 1050
                             |.|||..||     .|..|.......|  |:....:.|:.::|
Zfish   518 ENNLPFIFISSPSSSSSAAPPLHQLPLHLISIPSSSSAAPPLHQLPLFISSPSSSFHQQL 577

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Upf2NP_572434.1 MIF4G 104..300 CDD:214713
MIF4G 518..701 CDD:214713 76/157 (48%)
MIF4G 716..934 CDD:280935 94/217 (43%)
Upf2 980..1192 CDD:281974 29/123 (24%)
upf2XP_017210611.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H6101
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D653534at2759
OrthoFinder 1 1.000 FOG0003759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.