DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Upf2 and Upf2

Sequence 1:NP_572434.1 Gene:Upf2 FlyBaseID:FBgn0029992 Length:1241 Species:Drosophila melanogaster
Sequence 2:NP_001074601.1 Gene:Upf2 MGIID:2449307 Length:1269 Species:Mus musculus

Alignment Length:1260 Identity:464/1261 (37%)
Similarity:697/1261 (55%) Gaps:164/1261 (13%)


  Fly    42 DANADEDVDAAAAIALEAEEREELQQFISELREKIESKRQLRL--QNSTIELPGEEYFAKLDSNL 104
            :..|....:.|||   :.:|:||..|...|..|:.:.:::||.  ||:....|.|.:|::|||:|
Mouse   106 EEQAKRQQEEAAA---QLKEKEESLQLHQEAWERHQLRKELRSKNQNAPDNRPEENFFSRLDSSL 167

  Fly   105 KKNTAFVKKLKLFTATQLDGLLREISALNLSKYISEICAALVEAKLKMTDVPAVVTLASRLHCTY 169
            |||||||||||..|..|.|.|..:.:.|||||||:|..|::||||||::||.....|.|..|..|
Mouse   168 KKNTAFVKKLKTITEQQRDSLSHDFNGLNLSKYIAEAVASIVEAKLKLSDVNCAAHLCSLFHQRY 232

  Fly   170 ADFDVHFLEAWQKALNIKATEKIGNPSKLRVDLRLFAELVSSGVIQMKPGLAQLGVVLVHLIALD 234
            :||....|:.|:|....:..||..|.:|||.|||..|||...|:...|.||:.:...|..:|..|
Mouse   233 SDFAPSLLQVWKKHFEARKEEKTPNITKLRTDLRFIAELTIVGIFTDKEGLSLIYEQLKSIINAD 297

  Fly   235 KDDHSNFSIILSFCRHCGEEYAGLVPQKMQQLATKYGVEVPKSDFLTADKQLNLRTMLKGYFKAL 299
            ::.|::.|:::|||||||::.|||||:|::..|.|:.:..|.|:.::.:||...:.:||.||.:|
Mouse   298 RESHTHVSVVISFCRHCGDDIAGLVPRKVKSAAEKFNLSFPPSEIISPEKQQPFQNLLKEYFTSL 362

  Fly   300 CKHVLAEQAELMNMTKNIRRTMECKGEISTEKREKCELMQAGFDKLLASAQSLSELLGEPLPELA 364
            .||:..:..||.|..:..||.:..|||:|.::.::.|.....:.||||::|||::||.|.:|:|.
Mouse   363 TKHLKRDHRELQNTERQNRRILHSKGELSEDRHKQYEEFAMSYQKLLANSQSLADLLDENMPDLP 427

  Fly   365 KES---EGCNPGTVIDNMLDSASFGVLD----PWGDEETRAFYTDLPDLRQFLP----------- 411
            ::.   |...||  || :......|..|    .|.||:.|.||.:|.||:.|:|           
Mouse   428 QDKPTPEEHGPG--ID-IFTPGKPGEYDLEGGIWEDEDARNFYENLIDLKAFVPAILFKDNEKSQ 489

  Fly   412 NFSAPKVDLETLEEPSELTEEAIDANLDAE---MDLDDPPSTTSDTTPENPIEEQPTTPVAAAED 473
            |..:.|.|.:..:||.:..|.:...:|:.|   ::::|      ||......:|        |||
Mouse   490 NKDSNKDDSKEAKEPKDNKEASSPDDLELELENLEIND------DTLELEGADE--------AED 540

  Fly   474 LKPQKMGNALMELGRQQQQQSQLNQNPIQIQNQMRQQFDGFLVNLFNCVNKELIDSAAIEFLLNF 538
            | .:|:      |..|:|:..:.:..     :.::...|.||..|.||||::|||.||::|.:|.
Mouse   541 L-TKKL------LDEQEQEDEEASTG-----SHLKLIVDAFLQQLPNCVNRDLIDKAAMDFCMNM 593

  Fly   539 NTKHQRKKLTRTIFSVQRTRLDILPYLSRFVAIVHMCNTDVATDLAELLRKEFKWHIHKKNQLNI 603
            |||..||||.|.:|.|.|.|||:||:.:|.||.:|.|.:|||.||..:||.:|::|:.||:|:||
Mouse   594 NTKANRKKLVRALFIVPRQRLDLLPFYARLVATLHPCMSDVAEDLCSMLRGDFRFHVRKKDQINI 658

  Fly   604 ETKLKIVRFIGELVKFGLFKKFDALGCLKMLLRDFQHHQIEMACAFVEVTGVYLYNCRDARLLMN 668
            |||.|.|||||||.||.:|.|.|.|.||||||.||.||.|||||..:|..|.:|:...::.|..:
Mouse   659 ETKNKTVRFIGELTKFKMFTKNDTLHCLKMLLSDFSHHHIEMACTLLETCGRFLFRSPESHLRTS 723

  Fly   669 VFLDQMLRLKTATAMDSRHAAQIESVYYLVKPPESSKREPMVRPAMHEYIRYLIFEELCKQNVDR 733
            |.|:||:|.|.|..:|:|:...:|:.||...||.:.|.....||.:.||:|.|::::|.|...::
Mouse   724 VLLEQMMRKKQAMHLDARYVTMVENAYYYCNPPPAEKTVRKKRPPLQEYVRKLLYKDLSKVTTEK 788

  Fly   734 CIKMLRRIDWQDPETNCYAIKCLSKAYLLRFQLIRCLADLVSGLSSYQPRAVTIVIDNVFEDIRA 798
            .::.:|::.|||.|...|.|.|:...:.:::..|.|:|:|::||..||......|:|.|.||||.
Mouse   789 VLRQMRKLPWQDQEVKDYVICCMINIWNVKYNSIHCVANLLAGLVLYQEDVGIHVVDGVLEDIRL 853

  Fly   799 GLEIHSPRMAQRRIAMAKYLGEMYNYKLVESTNILNTLYSIISLGVSNDQNVVSPLDPPDSLFRL 863
            |:|::.|:..||||:.||:|||:|||::|||..|..||||..|.||:.|.: .|.||||:.|||:
Mouse   854 GMEVNQPKFNQRRISSAKFLGELYNYRMVESAVIFRTLYSFTSFGVNPDGS-PSSLDPPEHLFRI 917

  Fly   864 KLACMLLDTCAPYFTSQATRKKLDYFLVFFQHYYWFKKSHPVFSKTENTSDLFPILMDHTYRDCL 928
            :|.|.:||||..||...::::|||.|||:||.|.|:|||..|::|...    |||.:|:...|.|
Mouse   918 RLVCTILDTCGQYFDRGSSKRKLDCFLVYFQRYVWWKKSLEVWTKDHP----FPIDIDYMISDTL 978

  Fly   929 LNVRPKLKIYKSLEQAKAAIDHLQEKLYPQLKTTNNAQDPSLGT----ISEISEIDEGG--TDED 987
            ..:|||:|:..|||::...:..|:.:...:|...|:.:.....|    :.|..|.:|||  |:|.
Mouse   979 ELLRPKIKLCNSLEESIRQVQDLEREFLIKLGLVNDKESKDSMTEGENLEEDEEEEEGGAETEEQ 1043

  Fly   988 SGSSNDQR--------ERQVSGQEQDQSN-DW-----TENEAEPP----------LPPLPPPEKS 1028
            ||:.::..        |.:..|:|:::.| |:     .|||.:..          |..:|    .
Mouse  1044 SGNESEVNEPEEEEGSEEEEEGEEEEEENTDYLTDSNKENETDEENAEVMIKGGGLKHVP----C 1104

  Fly  1029 KEDLEFEQLYEKMTTDSYQERLKEPIKATAKDIPVPMMARLQKKSYDQITGAQTIGPGINNMSQI 1093
            .||.:|.|..:||..::.|:|..|.:|....|:.:|:..:                      ||:
Mouse  1105 VEDEDFIQALDKMMLENLQQRSGESVKVHQLDVAIPLHLK----------------------SQL 1147

  Fly  1094 SKSVPNQDGTPGSPGADSPDGNGKSGGGVGGSDVGAAGAAGASGATSVPFVLMVRGHKGGKQQFK 1158
            .|..|                   .|||.|.::          .|.::|||::.|  ||.|||||
Mouse  1148 RKGPP-------------------LGGGEGETE----------SADTMPFVMLTR--KGNKQQFK 1181

  Fly  1159 SFVAPSDSHLATNLKRQEQMIREEKEKVKRLTLNITERIEEEDYQESLMPPQHRNFTQSYYQKP- 1222
            ....|..|.||.|...|:|..:||:.::|:|||:|.||.|:|||||.|         ||..|:| 
Mouse  1182 ILNVPMSSQLAANHWNQQQAEQEERMRMKKLTLDINERQEQEDYQEML---------QSLAQRPA 1237

  Fly  1223 -------NKHKFKHQKGAPDADLIF 1240
                   .:.:::|.||||:|||||
Mouse  1238 PANTNRERRPRYQHPKGAPNADLIF 1262

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Upf2NP_572434.1 MIF4G 104..300 CDD:214713 87/196 (44%)
MIF4G 518..701 CDD:214713 96/183 (52%)
MIF4G 716..934 CDD:280935 95/218 (44%)
Upf2 980..1192 CDD:281974 62/238 (26%)
Upf2NP_001074601.1 MIF4G 167..362 CDD:214713 86/195 (44%)
DUF1451 357..>420 CDD:302977 24/63 (38%)
MIF4G 569..756 CDD:214713 95/187 (51%)
MIF4G 771..984 CDD:214713 92/213 (43%)
Upf2 1082..1215 CDD:281974 27/143 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C325624227
eggNOG 1 0.900 E1_KOG2051
Hieranoid 1 1.000
Homologene 1 1.000 H6101
Inparanoid 1 1.050 753 1.000 Inparanoid score I560
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003759
OrthoInspector 1 1.000 T1085564
orthoMCL 1 0.900 OOG5_129338
Panther 1 1.100 LDO PTHR12839
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R816
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.