DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Upf2 and upf2

DIOPT Version :8

Sequence 1:NP_572434.1 Gene:Upf2 / 31724 FlyBaseID:FBgn0029992 Length:1241 Species:Drosophila melanogaster
Sequence 2:NP_593784.1 Gene:upf2 / 2542147 PomBaseID:SPAC19A8.08 Length:1049 Species:Schizosaccharomyces pombe

Alignment Length:1196 Identity:272/1196 - (22%)
Similarity:473/1196 - (39%) Gaps:284/1196 - (23%)


  Fly    98 AKLDSNLKKNTAFVKKLK-LFTATQLDGLLREISALNLSKYISEICAALVEAKLK-------MTD 154
            ::|||:|||||||:|:.| ..|:...|..::||..|:|.|:|.||.||:||..:|       ::.
pombe    35 SQLDSSLKKNTAFMKRCKSSLTSENYDSFIKEIKTLSLKKFIPEITAAIVEGMMKCKATKDILSS 99

  Fly   155 VPAVVTLASR------------LHCT------YADFDVHFLEAWQKALNIKATEKIGNPSKLRVD 201
            |..|..|..|            |:|.      |:.....:.|..|....:...::..:..|:|..
pombe   100 VKIVWALNLRFSTAFTGPMLANLYCALYPNPGYSLCHESYFELKQNENEVSEKDRSSHLLKVRPL 164

  Fly   202 LRLFAELVSSGVIQMKPGLAQLGVVLVHLIALDKDD---------HSNFS---IILSFCRHCGEE 254
            ||...|...:||:........      :|.:.|.:|         ..|..   ::|.|.......
pombe   165 LRFLIEFWLNGVVGTPEDFVS------YLPSTDSNDKKFRKPWFEEQNLKKPLVVLLFNDLMDTR 223

  Fly   255 YAGLVPQKMQQLATKYGVEVPKSDFLTAD----------KQLN-------LRTMLKGYFKALCKH 302
            :..|:...:..|...:..|:    |.|.|          .:||       ||..|..|...|..:
pombe   224 FGFLLLPVLTSLVRTFSCEL----FTTEDFEDKETLELVNRLNPVVWRTYLRKSLNSYVDKLEVY 284

  Fly   303 VLAEQAELMNMTKNIRRTMECKGEISTEKREKCELMQAGFDKLLASAQSLSELL----GEPLPEL 363
            ....::....:.|..:.....:.:.:.||.::........:...:|..||||:|    .|.|.||
pombe   285 CQKRKSLFEELNKQYQEQSIIRADPNNEKFQRLANFSKSIESEFSSYASLSEVLNRKASEDLLEL 349

  Fly   364 ---AKESEGCNPGTVID---NMLDSASFGVLDPWGDEETRAFYTDLPDLRQFLPNFSAPKVDLET 422
               .|.|.|.|  :|.:   ...:||:......|.|.|...||       :..|||:...: .|.
pombe   350 NFMEKASSGTN--SVFNASGERSESANVETAQVWDDREQYFFY-------EVFPNFNEGSI-AEM 404

  Fly   423 LEEPSELTEEAIDANLDAEMDLDDPPSTTSDTTPENPIEEQPTTPVAAAEDLKPQKMGNALMELG 487
            .....|.::|.|.::.:.....||...:|.|                                  
pombe   405 KSSIYESSQEGIRSSSENNKKEDDLKDSTGD---------------------------------- 435

  Fly   488 RQQQQQSQLNQNPIQIQNQMRQQFDGFLVNLFNCVNKELIDSAAIEFLLNFNTKHQRKKLTRTIF 552
                    ||      ..|:..:.|.||:.|.:.|:.||.:..|:|| .:.|||..|.:|.:.:.
pombe   436 --------LN------TTQVSSRVDNFLLKLPSMVSLELTNEMALEF-YDLNTKASRNRLIKALC 485

  Fly   553 SVQRTRLDILPYLSRFVAIVHMCNTDVATDLAELLRKEFKWHIHKKNQLNIETKLKIVRFIGELV 617
            ::.||...::||..|...|:...:::.:|.|.:..|..||..||:|.:...:|:|.|||:|.||.
pombe   486 TIPRTSSFLVPYYVRLARILSQLSSEFSTSLVDHARHSFKRMIHRKAKHEYDTRLLIVRYISELT 550

  Fly   618 KFGLFKKFDALGCLKMLLRDFQHHQIEMACAFVEVTGVYLYNCRDARLLMNVFLDQMLRLKTATA 682
            ||.|........|.|:.:.:|....:|:....:|..|.:|....:.:|.|..||:.:.:.|.|:|
pombe   551 KFQLMPFHMVFECYKLCINEFTPFDLEVLALLLESCGRFLLRYPETKLQMQSFLEAIQKKKLASA 615

  Fly   683 MDSRHAAQIESVYYLVKPPES----SKREPMVRPAMHEYIRYLIFEELCKQNVDRCIKMLRRIDW 743
            :.|:....:|:..:.|.||:.    ||::.:    ..|::..||...|...||...:.:||:.||
pombe   616 LASQDQLVLENALHFVNPPKRGIIVSKKKSL----KEEFLYDLIQIRLKDDNVFPTLLLLRKFDW 676

  Fly   744 QDPETNCYAIKCLSKAYLLRFQLIRCLADLVSGLSSYQPRAVTIVIDNVFEDIRAGLEIHSPRMA 808
            :|.....|  ..:.:.:.:::..:..||.|:|.|..:.|.....|||:..|.:.:.:........
pombe   677 KDDYQILY--NTIMEVWNIKYNSLNALARLLSALYKFHPEFCIHVIDDTLESLFSAVNNSDHVEK 739

  Fly   809 QRRIAMAKYLGEMYNYKLVESTNILNTLYSIISL---------------GVSNDQNVVSPLDPPD 858
            |:|:|.|:::.|:....:::...|.|.|:.::.|               .::||           
pombe   740 QKRLAQARFISELCVIHMLDVRAITNFLFHLLPLEKFESFLTMKASTLTNINND----------- 793

  Fly   859 SLFRLKLACMLLDTCAPYFTSQATRKKLDYFLVFFQHYYWFKKSHPVFSKTENTSDLFPILMDHT 923
             :|||:|..::|.||.|......|:|.:..:|:.:|.|:..:..             .|:.|.:.
pombe   794 -MFRLRLIVVVLQTCGPSIIRSKTKKTMLTYLLAYQCYFLIQPE-------------MPLDMLYE 844

  Fly   924 YRDCLLNVRPKLKIYKSLEQAKAAI---------DHLQEKLYPQLKTTN----NAQDPSLGTISE 975
            :.|.:..|||.:|:|...|:|:.|:         |..::...|..:..|    ::.:.|:....:
pombe   845 FEDVIGYVRPSMKVYMHYEEARNALTERLQAISDDWEEDDTRPVFQGANDGDISSNEESVYLPED 909

  Fly   976 ISEIDEGGTDEDSGSSNDQRERQVSGQEQ----DQSNDWTENEAEPPLPPLPPPEKSKEDLEFEQ 1036
            ||  ||..|||:|           ||.|:    |..::..:||.:             ...|.::
pombe   910 IS--DESETDEES-----------SGLEESDLLDSEDEDIDNEMQ-------------LSRELDE 948

  Fly  1037 LYEKMTTDSYQERLKEPIKATAKDIPVPMMARLQKKSYDQITGAQTIGPGINNMSQISKSVPNQD 1101
            .:|::|.:|...|:.|  |....|:|:|:.|                                  
pombe   949 EFERLTNESLLTRMHE--KNPGFDVPLPLRA---------------------------------- 977

  Fly  1102 GTPGSPGADSPDGNGKSGGGVGGSDVGAAGAAGASGATSVPFVLMVRGHKGGKQQFKSFVAPSDS 1166
            .:.|||....   |.:|                ||.::.|.|.|:.:  :|.||:.:....||.|
pombe   978 SSLGSPYVTR---NEES----------------ASESSHVMFTLLTK--RGNKQRSQYLEIPSHS 1021

  Fly  1167 HLATNLKRQEQMIREEKEKVKRLTLN 1192
            .|..:.|.|:.....|:::||.:.||
pombe  1022 SLVRSTKNQQTEEIMERKRVKEMVLN 1047

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Upf2NP_572434.1 MIF4G 104..300 CDD:214713 58/250 (23%)
MIF4G 518..701 CDD:214713 54/182 (30%)
MIF4G 716..934 CDD:280935 51/232 (22%)
Upf2 980..1192 CDD:281974 45/215 (21%)
upf2NP_593784.1 MIF4G 41..281 CDD:295415 58/249 (23%)
MIF4G 447..634 CDD:214713 56/187 (30%)
MIF4G 649..855 CDD:280935 51/232 (22%)
Upf2 901..1047 CDD:281974 48/228 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H6101
Inparanoid 1 1.050 220 1.000 Inparanoid score I893
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003759
OrthoInspector 1 1.000 T1125940
orthoMCL 1 0.900 OOG5_129338
Panther 1 1.100 LDO PTHR12839
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R816
TreeFam 1 0.960
1110.960

Return to query results.
Submit another query.