DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fs(1)h and BDF2

Sequence 1:NP_001259321.1 Gene:fs(1)h FlyBaseID:FBgn0004656 Length:2046 Species:Drosophila melanogaster
Sequence 2:NP_010213.1 Gene:BDF2 SGDID:S000002228 Length:638 Species:Saccharomyces cerevisiae

Alignment Length:716 Identity:140/717 (20%)
Similarity:230/717 (32%) Gaps:322/717 (45%)


  Fly     2 SSSEPPPRYEPPVEP-VNGIVQPPVIPPAERPGRNTNQLQYLIKTVMKVIWKHHFSWPFQQPVDA 65
            |..|.|...|...|| :...::...:||        :|.:||:.:: |...:...:.||.:|||.
Yeast   109 SFPEHPLGLERETEPALEAEMEAEELPP--------HQSKYLLSSI-KATKRLKDARPFLKPVDP 164

  Fly    66 KKLNLPDYHKIIKQPMDMGTIKKRLENNYYWSAKETIQDFNTMFNNCYVYNKPGEDVVVMAQTLE 130
            ..||:|.|...::.|||:..|:.:|:.|.|.|.::...||.||.:||..:|.|...:..||:.::
Yeast   165 IALNIPHYFNYVQTPMDLSLIETKLQGNVYHSVEQVTSDFKTMVDNCLNFNGPESSISSMAKRIQ 229

  Fly   131 KVFLQKIESMPKEELELEPV--TAKGGKKKQRAPATPKSSSGGAGASTGSGTSSAAVTSGPGSGS 193
            |.|.:|:.:||...|....:  |::..||.:...:                              
Yeast   230 KYFEKKLSAMPPRVLPASALKKTSRNRKKNEDMDS------------------------------ 264

  Fly   194 TKVSVAASSAQQSGLQGATGAGGGSSSTPGTQPGSGAGGAIAARPVSAMGGTVSSTAGGAPSIPP 258
                                                                             
Yeast   265 ----------------------------------------------------------------- 264

  Fly   259 ISTMPPHTVPGSTNTTTTAMAGGVGGPGAAGANPNAAALMASLLNAGQTGAYPGAPGQTAVNSSS 323
                 |..:..|.:||..                          |.|:                 
Yeast   265 -----PLVIRRSVSTTND--------------------------NIGE----------------- 281

  Fly   324 LLDGSTAAVAAAAAAAAAAAAAAGGAAGAAGGAGTIPAVAVNAANAVQAYVNAGVSVGVDAVIPP 388
                                  :|...|.:||.   |...::                     ||
Yeast   282 ----------------------SGNREGVSGGR---PKRTIH---------------------PP 300

  Fly   389 QQPAKIKKGVKRKADTTTPTANAFESPYTQMDSKSAKIATRRESNRQVIGKKGSGYNMSPLGVSG 453
                                             ||..:....|:                     
Yeast   301 ---------------------------------KSKDLFDIYEN--------------------- 311

  Fly   454 VPGLGGLVAGGVAGVAVAKNKEK-LSDALKSCNEILKELFSKKHSGYAWPFYKPVDAEMLGLHDY 517
                             :|.|.| |....::|.:|||.|.|||:|...:||.:|||...|.|.:|
Yeast   312 -----------------SKPKSKTLQKKFRTCLKILKVLMSKKNSDINFPFLQPVDPIALNLPNY 359

  Fly   518 HDIIKKPMDLGTVKRKMDNREYKSAPEFAADVRLIFTNCYKYNPPDHDVVAMGRKLQDVFEMRYA 582
            .|::|.||||||:...:.|.:||:..:|..|:.|:|.||:::||..::|.:||:||:::|...: 
Yeast   360 FDVVKNPMDLGTISNNLMNWKYKTIDQFVDDLNLVFYNCFQFNPEGNEVHSMGKKLKELFNFHW- 423

  Fly   583 NIPDEPVANAAHHHGHGHGHGHGHGHGHGHGHGHGHGHGYGGSSSLKHD--ASDSSSEDSSDTEN 645
             :.::.:.|...                             ..|.|:.|  :|..||:|..|.|:
Yeast   424 -LENQDILNEIE-----------------------------TDSDLEEDNYSSSYSSDDEYDDED 458

  Fly   646 ESNSDEERSA------RLKMLESKLLGL-QEEIRKLSEEASAKKKAKKKLKEK---------KKS 694
            .:.:|....|      :||.:|.:|..| ::|:.|||:|...|...|..|:.|         |||
Yeast   459 INENDITNPAIQYLEQKLKKMEVELQQLKRQELSKLSKERKRKHLGKTLLRRKAMKHSVDDLKKS 523

  Fly   695 I 695
            |
Yeast   524 I 524

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fs(1)hNP_001259321.1 Bromo_Brdt_I_like 34..140 CDD:99929 34/106 (32%)
COG5076 387..>593 CDD:227408 52/207 (25%)
Bromo_Brdt_II_like 481..581 CDD:99930 42/100 (42%)
BET 951..1015 CDD:293640
BRD4_CDT <2026..2046 CDD:293710
BDF2NP_010213.1 COG5076 55..378 CDD:227408 93/538 (17%)
Bromodomain <344..419 CDD:321986 32/75 (43%)
BET 521..576 CDD:319097 4/5 (80%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5076
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 232 1.000 Inparanoid score I717
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000242
OrthoInspector 1 1.000 T133813
orthoMCL 1 0.900 OOG5_126719
Panther 1 1.100 O PTHR22880
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3378
TreeFam 1 0.960
109.850

Return to query results.
Submit another query.