DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubr3 and Ubr3

DIOPT Version :8

Sequence 1:NP_001259317.1 Gene:Ubr3 / 31713 FlyBaseID:FBgn0260970 Length:2236 Species:Drosophila melanogaster
Sequence 2:XP_006224535.1 Gene:Ubr3 / 311115 RGDID:1565257 Length:1901 Species:Rattus norvegicus

Alignment Length:2286 Identity:738/2287 (32%)
Similarity:1080/2287 (47%) Gaps:560/2287 (24%)


  Fly    98 SSVAAAAAPPPPPPRT---GPTTTTSSGTAAESGAASALSDD-AGAKPSFFFGASSFSLRSRKEV 158
            ::.||...|.||.|..   || |...:.|||...||.:..|: |||:                  
  Rat     4 AAAAAVGGPQPPQPEVSAQGP-TLDKAATAAHLKAALSRPDNRAGAE------------------ 49

  Fly   159 AALINTECCRGSPTPDLDSIMDTLFNPGTPIDNL-----------------DNIEWIRWLIAGGR 206
                           :|.::::.:.|...|:...                 |.:||.:.|:|||.
  Rat    50 ---------------ELQALLERVLNAERPLARAAGGEEAAGGGSPGEAEEDALEWCKCLLAGGG 99

  Fly   207 TPQEFVKIVRSYDNHAKCGLVWVPHVVAYRCRTCGISPCMSICRDCFKKGNHTNHDFNMFLSQAG 271
            ...||...||:||..|.|||||..:.|||||||||||||||:|.:||.:|:||.||||||.||||
  Rat   100 GYDEFCAAVRAYDPAALCGLVWTANFVAYRCRTCGISPCMSLCAECFHQGDHTGHDFNMFRSQAG 164

  Fly   272 GACDCGDTSVMKAEGFCSDHGINNRVNRDPVPNNLLAVAEAIMPKLLFRLLQHFRE-----HSDT 331
            |||||||::||:..|||..|.|.:..|...||.:||.::|.::|:.:|.|:|:.||     .:||
  Rat   165 GACDCGDSNVMRESGFCRRHQIKSSSNIPCVPKDLLMMSEFVLPRFIFCLIQYLREGYNEPAADT 229

  Fly   332 PLE------VQAITSYSCEEFANMLIDLNNMGEIMRKVMTRTLINPEVY----AFFMEAPCQDTR 386
            |.|      :|.:     |...:.|.||...|..||.|:|:.|.|.:.|    |...|..|    
  Rat   230 PSEKDLNKVLQLL-----EPQISFLEDLTKTGGAMRAVLTQVLTNQQSYKDLTAGLGENTC---- 285

  Fly   387 NGRFLKANREKYEDAVN----RFPN-------PEPPDEYRDLPALG------------------- 421
                .|.:.|||..|:.    .:|.       .||......|.|.|                   
  Rat   286 ----AKKSHEKYLIALKSSGLTYPEDKLVYGIQEPSAGTSTLAAQGFAGATGTLGQIDSSDEEDQ 346

  Fly   422 ------------------------DKLVHTTLLEEFIFWTFKFEFPQTLVCFLLNMLPDQDYKEH 462
                                    |.|.|.:.|||.:|||.|:||||.:|.|||||||||:||..
  Rat   347 DGSQGLGKRKRVKLSSGTKDQSIMDVLKHKSFLEELLFWTIKYEFPQKMVTFLLNMLPDQEYKVA 411

  Fly   463 LTRTFVMHYSRIPSVLEMSRDPDTLSNRVVHMSVQLFSNESLALKMVNELSLLHVMIISLKLMMS 527
            .|:|||.||:.|...|:.|.:.||:|||:||:||||||||.||.::..|..||.:|:..|..||.
  Rat   412 FTKTFVQHYAFIMKTLKKSHESDTMSNRIVHISVQLFSNEELARQVTEECQLLDIMVTVLLYMME 476

  Fly   528 KILIQNTLHDPNKNFHFVIDCTRQVMKDHCYWPLVSDFNNVLSHESVALVFLRDDNLIDMWFQFL 592
            ..||::.|.|...:.|.|::|...::|::.||||||||.|:|||:|||..||.|..|:..|..|:
  Rat   477 SCLIKSELQDEENSLHVVVNCGEALLKNNTYWPLVSDFINILSHQSVAKRFLEDHGLLVTWMNFV 541

  Fly   593 QMLQGMNVNVRETASHVEFEPNSYYAAFSCELEASAYPMWSIISHLQDGTHAHLAKKIINYCVTT 657
            ...||||:|.||...|||||..:|||||:.||||.|.|||.::||.:........:.::.||:..
  Rat   542 SFFQGMNLNKRELNEHVEFESQTYYAAFAAELEACAQPMWGLLSHCKVRETQEYTRNVVRYCLEA 606

  Fly   658 LHEWLDSIYFMEARLSMEEMMQASFHFPLHRYLAAFVCQAVTKMGISLNDVLPSRPYLLPLLMIH 722
            |.:|.|:|.|::.    ....|.:||.|||||.|.|:.:||....:.|:.:||.:..|:. ||||
  Rat   607 LQDWFDAINFVDE----PAPNQVTFHLPLHRYYAMFLSKAVKCQELDLDSLLPDQEMLMK-LMIH 666

  Fly   723 PLRVQSFFYEILAGKWVRNGLQIKGQAMTYIQANFCNSMADMDLFFLQICATNLPQYFFLQNTIE 787
            ||::|:...||.:..|||||||||||||||:|::|||||.|.|::.||:||:.|...:|:.:..|
  Rat   667 PLQIQASLAEIHSNMWVRNGLQIKGQAMTYVQSHFCNSMIDPDIYLLQVCASRLDPDYFISSVFE 731

  Fly   788 LFDVGQWLETAPLKQPQKAE---QSSMLEGFLTFLATLVTSRTNLG--NDEATQCIIEISALLAT 847
            .|.|...|..|........:   :.|||||.||||..|::.|.:||  :||..:.  |:.|.|..
  Rat   732 RFKVVDLLTMASQHHNMVLDVEHERSMLEGALTFLVILLSLRLHLGMSDDEILRA--EMVAQLCM 794

  Fly   848 ENKTHSQLLELMPE----RSGNV-HTKNFETFLKKLSVYKAP---SSGSENLEQGLFTPIDEVWE 904
            .::|||.||:|:||    :||.: .:.:||:.|..::.:|||   ..||  ::||::||..|||:
  Rat   795 NDRTHSSLLDLIPENPNPKSGIIPGSYSFESVLSAVADFKAPVFEPGGS--MQQGMYTPKAEVWD 857

  Fly   905 KHYDPLHVLLRAVHRRDFQSSLDRFTNYVKSKDKMPASGNLWPPFRLPHALPATSSFSDPCKILN 969
            :.:||:.|:||.|:|||.||::||:|.::|...|.  |||.|||::...:|  ..|:....::|:
  Rat   858 QEFDPVMVILRTVYRRDVQSAMDRYTAFLKQSGKF--SGNPWPPYKKRTSL--HPSYKGLMRLLH 918

  Fly   970 SRIFHSTILSIFFRAV--HTRDVSEHLLALAVFLLEIAVETS------DDVGSGTGDRAPPALAA 1026
            .:..|..:.::.::.:  | :::|||:|.:.::|:|:.:|.|      ::|..|..:|.      
  Rat   919 CKTLHIVLFTLLYKILMDH-QNLSEHVLCMVLYLIELGLEDSAEDDSEEEVSMGGPERC------ 976

  Fly  1027 VVESSSGPGYHGYGTGRHEPPKLFHCYPTDNLSCNLRHVVKKVSLKSRDPQVITSSYRSNPFYSD 1091
                             |:     ..:|..||..|:||.:..|  :.|.|               
  Rat   977 -----------------HD-----SWFPGSNLVSNMRHFINYV--RVRVP--------------- 1002

  Fly  1092 LDFEVEADPEQSMRMIGQGDPEGDEATGGAGLGMGAHSRR-------NVSQALVPMRVPGMEVAL 1149
                 |..||.....:.        :|...|||...:|||       |...|.|           
  Rat  1003 -----ETAPELKRDSLA--------STSSDGLGSLQNSRRPKVLQRENSGTAQV----------- 1043

  Fly  1150 PPDLSVVAETGVVIRQDSNEDDLLREGNHAMDMSPPAALDFHFPLQQITLPESGMEVAIRRDLLL 1214
               .|:|||     |:...::.:.|..:.|                                   
  Rat  1044 ---FSLVAE-----RRKKFQEIINRNNSEA----------------------------------- 1065

  Fly  1215 AETNNMGAIAGGAGGGANASATPPAGASNEMFSPTTPTGSGMLLPFQRVQPVAVPSSGNMDIVPS 1279
                                        |::..|.||:                         ..
  Rat  1066 ----------------------------NQVVRPKTPS-------------------------KW 1077

  Fly  1280 NAMGAGGSFTSGVSGSGTGRRMNYETGGARKRSVDIAIGGSNKDELHLDESILSLLLKLHSQLSG 1344
            :|.|:....|:.:                                |.:.|||||||:|||.:|||
  Rat  1078 SAPGSAPQLTTAI--------------------------------LEIKESILSLLIKLHHKLSG 1110

  Fly  1345 TLDSFS---LSDGEDQSSDDDSTMDVDCNEASTSMAAAESTALAERGRSKRNYKNIHVSSSRIGD 1406
            ..:|:.   |.|.|                           .|.:....|.::          ||
  Rat  1111 KQNSYYPPWLDDIE---------------------------VLIQPEIPKYSH----------GD 1138

  Fly  1407 GPFFIGNLLRKIAKQDEQCAQSIDDIRARLWPNQREKQAEAKAREAKEKEERRKKARERQQKMMQ 1471
            |...:..:|.|.|.|.....:.|::|..::.|....|:.....::..:|||||:||||||||::.
  Rat  1139 GITAVERILLKAAVQSRMNKRIIEEICRKVTPPVPPKKITTAEKKTLDKEERRQKARERQQKLLA 1203

  Fly  1472 DFANKQKLFMQSAAASSSGMGYGPEDEDDEELYEEQPREKE--YDCIICNCTTPSTESNPIGLVV 1534
            :||::||.||::|....|     ||::...|:...:|:..|  |||:||..:.||:|..|.||||
  Rat  1204 EFASRQKSFMETAMDVDS-----PENDIPMEITTAEPQVSEAVYDCVICGQSGPSSEDRPTGLVV 1263

  Fly  1535 LVESSGIVGHRRRIAERLPLPINAEDESRLAHTTRLAAEFNRRTELLSLKFGDESWYLSNNMAYD 1599
            |:::|.::|..|...|...|||.  :|.::......||..:.|..||...|.|.|..|:.::.::
  Rat  1264 LLQASSVLGQCRDNVEPKKLPIT--EEEQIYPWDTCAAVHDVRLSLLQRYFKDSSCLLAVSIGWE 1326

  Fly  1600 NGVHVQSCGHHVHLSCLEAYLKTLYTTQRQPVQ----DRGEFYCPVCRQLSNSVLPLSPQLDRPT 1660
            .||:||:|||.:|:.|.::|:::|  ...|.:|    |:|||.||:|||.:|||||..|..:...
  Rat  1327 GGVYVQTCGHTLHIDCHKSYMESL--RNDQVLQGFSVDKGEFTCPLCRQFANSVLPCYPGSNVEN 1389

  Fly  1661 HL-VRSGNQPFERLVADLTDLIKENE-----------TIPQPTKLTEAMGHAMEVMTNIAQRKVK 1713
            :| .|..|:..:       |||||.|           :|...|.|::.|...|:.:.|..|:|.:
  Rat  1390 NLWQRPSNKSTQ-------DLIKEVEELQGRPGAFPVSISSETNLSKEMESVMKDIKNTTQKKYR 1447

  Fly  1714 CSSITFRKL---FIFVTSIARTNLEAEIIQRGGSLCTANATRYKPKRECIVPLLHVLSVHVRVLV 1775
            ..|.|....   |:|:.|:||||||.|:|.||||||:..|:. ..||.|:..|.|||::|:|:..
  Rat  1448 DYSKTPGSPDNDFLFMYSVARTNLELELIHRGGSLCSGGAST-AGKRSCLNQLFHVLALHMRLYT 1511

  Fly  1776 EWPLWSSWASLAGL------PVTATEPLPAHCLELIPSILADPIALLLKFILLAPLQLDQDYFTC 1834
            ....::.|..|..|      .|.:.:..|.     :|.:..|..:|||..||:.|..|.:::|||
  Rat  1512 IDSEYNPWKKLTHLVEDMNSQVGSEDQQPE-----VPVLYHDVTSLLLIQILMMPQPLQKEHFTC 1571

  Fly  1835 MVKVMYNLLYYQIVVQLCVTLTDLECDHIVKVYGSTSVGSDNSAAESQQQESAAGTTNNRRRAGQ 1899
            :|||::.|||.|.:..|.|..|:                .|.||               .:..|.
  Rat  1572 IVKVLFTLLYTQALAALSVKGTE----------------EDRSA---------------WKHLGA 1605

  Fly  1900 QQQSSSQLGKA----MALVLSQTNDLVHLRRDCIPSTSSSAAASAAGSSSTTSTNHGASAATASS 1960
            .::.:....|:    :..|:|:.                        |........||...|..|
  Rat  1606 LKKDTCDAEKSYEVLLGFVISEL------------------------SKGKLYCEEGAQECTMVS 1646

  Fly  1961 ATTIEVNLKSMELQLQALCLPFLRVAALLRQHLYRHEMPEISAPGLEFVRLVYYLELV-----TD 2020
              .|..:.:|||..:|..||||||:::||:.||:..::|...... ||..|...|.|:     ||
  Rat  1647 --PIAWSPESMERYIQDFCLPFLRISSLLQHHLFGEDLPSCQEEE-EFSVLASCLGLLPTFYQTD 1708

  Fly  2021 -------SMDWDCFNASKGLCFIPGTETTLPQFWCQQLMEVRP----PADTVRELVLINQHSLWQ 2074
                   .:||            |.....:...||   .|:|.    .||..:.|::  |.|.|:
  Rat  1709 HPFISASCLDW------------PVAAFDIITQWC---FEIRSFTERHADQGKALLI--QESRWK 1756

  Fly  2075 QPRLLELPREYERLFTYYHERPCLNCYKVPKESSICLLCGTIVCLKQNCCAENDCCEAVRHTLSC 2139
            .|.||:||..|..:|.|||.:.|..|.||||:.::||:||..||||..||.:...||.|.|:.:|
  Rat  1757 LPHLLQLPENYNTIFQYYHRKTCSVCTKVPKDPAVCLVCGAFVCLKGLCCKQQSYCECVLHSQNC 1821

  Fly  2140 GGGIGIFLVVTSTYIIVIRGRRACLWGSLYLDDFDEEDRDLKRGKPLYLSKDRFNLLESQWLSHK 2204
            |.|.||||::.::.||:|||.|.|||||:|||...||||||:||||||:.::|:.:||.||:||.
  Rat  1822 GAGTGIFLLINASVIIIIRGHRFCLWGSVYLDAHGEEDRDLRRGKPLYICEERYRVLEQQWVSHT 1886

  Fly  2205 FAHTKHTWVFH 2215
            |.|....|..|
  Rat  1887 FDHINKRWGPH 1897

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubr3NP_001259317.1 zf-UBR 224..291 CDD:280386 48/67 (72%)
FliJ <1410..1477 CDD:280262 23/67 (34%)
Ubr3XP_006224535.1 zf-UBR 117..184 CDD:280386 48/67 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48694119
eggNOG 1 0.900 E1_KOG1139
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H52092
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005892
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR21497
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
76.900

Return to query results.
Submit another query.