DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubr3 and ubr3

DIOPT Version :8

Sequence 1:NP_001259317.1 Gene:Ubr3 / 31713 FlyBaseID:FBgn0260970 Length:2236 Species:Drosophila melanogaster
Sequence 2:XP_012826536.1 Gene:ubr3 / 100498471 XenbaseID:XB-GENE-1219144 Length:1866 Species:Xenopus tropicalis

Alignment Length:2183 Identity:710/2184 (33%)
Similarity:1054/2184 (48%) Gaps:450/2184 (21%)


  Fly   153 RSRKEVAALINTECCRGSPTPDLD---SIMDTLFNPGTPIDNLDNIEWIRWLIAGGRTPQEFVKI 214
            |.::..|||:.::..|...:|.|:   .::|.:...|.|..  :.:||.:.|:|||...::|.:.
 Frog    10 RDKEATAALLKSKLSRPDQSPGLERLNGLLDRVLCVGGPAG--EALEWCKCLLAGGDKFEDFCQA 72

  Fly   215 VRSYDNHAKCGLVWVPHVVAYRCRTCGISPCMSICRDCFKKGNHTNHDFNMFLSQAGGACDCGDT 279
            ||||||...|||||..:.|||||||||||||||:|.:||.:|.|..||||||.|||||||||||:
 Frog    73 VRSYDNATLCGLVWTANFVAYRCRTCGISPCMSLCAECFHQGEHAGHDFNMFRSQAGGACDCGDS 137

  Fly   280 SVMKAEGFCSDHGINNRVNRDPVPNNLLAVAEAIMPKLLFRLLQHFREHSDTP-------LEVQA 337
            :||:..|||..|.:........||.:||.::|.::|:.:|.|:|:.|:....|       .::|.
 Frog   138 NVMRESGFCKRHRVKLSSCVPSVPQDLLVMSELVIPRFIFYLIQYLRDGYSEPGAEASPEKDLQK 202

  Fly   338 ITSYSCEEFANMLIDLNNMGEIMRKVMTRTLINPEVYAFFMEAPCQDTRNGRFLKANREKY---- 398
             |....:...:.|.||..||..||.|:|:.|.|.::|......|.:.|     ...:.|||    
 Frog   203 -TLQMLDPQISFLEDLTKMGGAMRSVLTQVLTNQQLYKDLSSGPGEST-----CSKSHEKYLIAL 261

  Fly   399 --------EDAVNRFPNPEPP------------------------DEYRD--------------- 416
                    |:.|:.....:.|                        :|.:|               
 Frog   262 KESGLSIPEENVSSGAQEQSPGTSTLAVKEVAGAEGAQGQLESSDEEDQDGRQCVGKRKRVKLSS 326

  Fly   417 ---LPALGDKLVHTTLLEEFIFWTFKFEFPQTLVCFLLNMLPDQDYKEHLTRTFVMHYSRIPSVL 478
               ..::.|.|.|...|||.:|||.|:||||.:|.||||||||||||...|:|||.||:.|...|
 Frog   327 NTKDQSIMDMLKHKCFLEELLFWTIKYEFPQKMVTFLLNMLPDQDYKIAFTKTFVQHYAFIMKTL 391

  Fly   479 EMSRDPDTLSNRVVHMSVQLFSNESLALKMVNELSLLHVMIISLKLMMSKILIQNTLHDPNKNFH 543
            :.|.:.||:|||:||:||||||||.||.::..|..||.:|:..|..||...||::.|.|...:.|
 Frog   392 KKSHESDTMSNRIVHISVQLFSNEELARQVTEECQLLDIMVTVLLYMMESCLIKSELQDEENSLH 456

  Fly   544 FVIDCTRQVMKDHCYWPLVSDFNNVLSHESVALVFLRDDNLIDMWFQFLQMLQGMNVNVRETASH 608
            .|::|...::|::.||||||||.|:|||:|||..||.|..|:..|..|:...||||:|.||...|
 Frog   457 VVVNCGEALLKNNTYWPLVSDFINILSHQSVAKKFLEDHGLLVTWMNFVSFFQGMNLNKRELTEH 521

  Fly   609 VEFEPNSYYAAFSCELEASAYPMWSIISHLQDGTHAHLAKKIINYCVTTLHEWLDSIYFMEARLS 673
            ||||..:|||||:.||||.|.|||.::||.:........:.::.||:..|.:|.|:|.|::.   
 Frog   522 VEFESQTYYAAFAAELEACAQPMWGLLSHCKVPDTQEYTRNVVRYCLEALQDWFDAINFVDE--- 583

  Fly   674 MEEMMQASFHFPLHRYLAAFVCQAVTKMGISLNDVLPSRPYLLPLLMIHPLRVQSFFYEILAGKW 738
             ....|.:||.|||||.|.|:.:|:....|.|:.:||.:..|:. ||:|||.:|:...||.:..|
 Frog   584 -PAPNQVTFHLPLHRYYAMFLSKAIKCQEIDLDSILPDQEMLMK-LMVHPLLIQASLSEIHSNMW 646

  Fly   739 VRNGLQIKGQAMTYIQANFCNSMADMDLFFLQICATNLPQYFFLQNTIELFDVGQWLETAPLKQP 803
            ||||||||||||||:|::|||||.|.|::.||:||:.|...:|:.:..|.|.|...|..|...|.
 Frog   647 VRNGLQIKGQAMTYVQSHFCNSMIDPDIYLLQVCASKLDPDYFISSVFERFKVVDLLTMASQHQN 711

  Fly   804 QKAE---QSSMLEGFLTFLATLVTSRTNLG--NDEATQCIIEISALLATENKTHSQLLELMPE-- 861
            ...:   :.|||||.||||..|::.|.:||  :||..:.  |:.:.|...::|||.||:|:||  
 Frog   712 TVLDADHERSMLEGALTFLVILLSLRLHLGMTDDEILRA--EMISQLCMNDRTHSSLLDLIPESP 774

  Fly   862 --RSGNV-HTKNFETFLKKLSVYKAP---SSGSENLEQGLFTPIDEVWEKHYDPLHVLLRAVHRR 920
              :||.: .:.:||:.|..::.:|||   ..||  ::||::||..::|::.:||:.|:||.|:||
 Frog   775 NPKSGIMPGSCSFESVLSAVADFKAPVFEPGGS--MQQGMYTPKGDIWDQEFDPVMVILRTVYRR 837

  Fly   921 DFQSSLDRFTNYVKSKDKMPASGNLWPPFRLPHALPATSSFSDPCKILNSRIFHSTILSIFFRAV 985
            |.||::||:|.::|...:.  |||.|||::  ...|...|:....::|:.:..|..:.::.::.:
 Frog   838 DVQSAMDRYTAFLKQSGRF--SGNPWPPYK--KRSPLHHSYKGLMRLLHCKTLHIVLFTLLYKIL 898

  Fly   986 --HTRDVSEHLLALAVFLLEIAVETSDDVGSGTGDRAPPALAAVVESSSGPGYHGYGTGRHEPPK 1048
              | :::|||:|.:.::|:|:.:|.|            |...:..|:.:||.             
 Frog   899 MDH-QNMSEHVLCMVLYLIELGLENS------------PEDESCEENFAGPD------------- 937

  Fly  1049 LFHC----YPTDNLSCNLRHVVKKVSLKSRDPQVITSSYRSNPFYSDLDFEVEADPEQSMRMIGQ 1109
              .|    :|..||.||:||.:..|  :.|.|                    |..||.      :
 Frog   938 --RCHDSWFPGSNLLCNMRHFINYV--RVRVP--------------------ETAPEV------R 972

  Fly  1110 GDPEGDEATGGAGLGMGAH-----SRRNVSQALVPMRVPGMEVALPPDLSVVAE-----TGVVIR 1164
            .:|....:|.|......|.     .|.|...|.|              .|:|||     ..::.|
 Frog   973 REPPASTSTDGPSSAQNARRPSLLQRENSGTAQV--------------FSLVAERRKKFQEIINR 1023

  Fly  1165 QDSNEDDLLREGNHAMDMSPPAALDFHFPLQQITLPESGMEVAIRRDLLLAETNNMGAIAGGAGG 1229
            .:|..:.::|..:.|:..:.|.|                                          
 Frog  1024 NNSEANQVVRPKSSALKWTAPGA------------------------------------------ 1046

  Fly  1230 GANASATPPAGASNEMFSPTTPTGSGMLLPFQRVQPVAVPSSGNMDIVPSNAMGAGGSFTSGVSG 1294
                                ||..:.::                                     
 Frog  1047 --------------------TPQLTTVI------------------------------------- 1054

  Fly  1295 SGTGRRMNYETGGARKRSVDIAIGGSNKDELHLDESILSLLLKLHSQLSGTLDSFS---LSDGED 1356
                                          |.:.||:||||:|||.:|||..||:.   |.|.|.
 Frog  1055 ------------------------------LEVKESMLSLLIKLHKKLSGKQDSYCPPWLDDPEC 1089

  Fly  1357 QSSDDDSTMDVDCNEASTSMAAAESTALAERGRSKRNYKNIHVSSSRIGDGPFFIGNLLRKIAKQ 1421
            ....|   :...|:                                  |||...:..:|.|.|.|
 Frog  1090 LVQPD---LPGYCH----------------------------------GDGVTAVERILLKAASQ 1117

  Fly  1422 DEQCAQSIDDIRARLWPNQREKQAEAKAREAKEKEERRKKARERQQKMMQDFANKQKLFMQSAAA 1486
            .....||||:|..:..|....|::....::...|||||:||||||||::.:||::||.||::|..
 Frog  1118 SRLNRQSIDEICKKAPPPVPPKKSSPADKKTLGKEERRQKARERQQKLLAEFASRQKSFMETAMD 1182

  Fly  1487 SSSGMGYGPEDEDDEEL--YEEQPREKEYDCIICNCTTPSTESNPIGLVVLVESSGIVGHRRRIA 1549
            ..|     ||.:...|:  .|:...|..|||:||..:.||||..|:|||||:::|.::||||:..
 Frog  1183 VES-----PESDVAMEIAGAEQHVAEPIYDCVICGQSGPSTEDRPLGLVVLLQASSVLGHRRKST 1242

  Fly  1550 ERLPLPINAEDESRLAHTTRLAAEFNRRTELLSLKFGDESWYLSNNMAYDNGVHVQSCGHHVHLS 1614
            |...||  ..:|.::......||..:.:..:|...|.|.|...|.::.::.||:||:|||.:|:.
 Frog  1243 EPKKLP--TTEEEQIYQEGTCAAANDVKLAILQRYFKDSSCLQSVSVGWEGGVYVQTCGHTLHID 1305

  Fly  1615 CLEAYLKTLYTTQRQPVQ----DRGEFYCPVCRQLSNSVLPLSP--QLDRPT-HLVRSGNQPFER 1672
            |.::|:::|  ...|.:|    |:|||.||:|||.:|||||..|  ..:|.: |...:.::..:.
 Frog  1306 CHKSYMESL--RNDQVLQGFSVDKGEFTCPLCRQFANSVLPCFPGDSTERGSWHSHAASSKSLQE 1368

  Fly  1673 LVADLTDLIKENETIP----QPTKLTEAMGHAMEVMTNIAQRKVKCSSITFRKL---FIFVTSIA 1730
            |:.::.||.::..|.|    ..|.|::.|...|:.:.:..|:|....|.|....   |:|:.|:|
 Frog  1369 LIKEVEDLQEQLGTFPVSISSETNLSKEMEAVMKDIKSTTQKKYTDYSKTQGSPDNDFLFMYSVA 1433

  Fly  1731 RTNLEAEIIQRGGSLCTANATRYKPKRECIVPLLHVLSVHVRVLVEWPLWSSWASLAGLPVTATE 1795
            |||||.|:|..|.:||:..|:. ..||.|:..|.|||::|:|:....|.::.|..|.  .|...:
 Frog  1434 RTNLELELIHCGDNLCSGGASA-AGKRSCLNQLFHVLAMHMRLYSIDPEYNPWKKLT--QVIQKK 1495

  Fly  1796 PLPAHCL------ELIPSILADPIALLLKFILLAPLQLDQDYFTCMVKVMYNLLYYQIVVQLCVT 1854
            |    .|      |.:|.:..|..:|||..:|..|..|.:::|.|:|||:|.|||.|.:..|.|.
 Frog  1496 P----SLGDDEEREEVPILFRDVTSLLLIQVLTMPQPLCKEHFVCIVKVLYTLLYTQAITSLSVK 1556

  Fly  1855 LTDLECDHIVKVYGSTSVGSDNSAAESQQQESAAGTTNNRRRAGQQQQSSSQLGKAMALVLSQTN 1919
            |                      .||.::.         .|.:|..::||...||....:|... 
 Frog  1557 L----------------------QAEDRKV---------WRESGSSKKSSYSSGKPWEALLGFV- 1589

  Fly  1920 DLVHLRRDCIPSTSSSAAASAAGSSSTTSTNHGASAATASSATTIEVNLKSMELQLQALCLPFLR 1984
                        .|..:..|......|.|.|.....|....|         :|..||..||||||
 Frog  1590 ------------ISELSRGSLYQDEETDSINMSDFTAWYEDA---------IEHYLQQFCLPFLR 1633

  Fly  1985 VAALLRQHLYRHEMPEISAPGLEFVRLVYYLELVTDSMDWDCFNASKGLCFIPGTETTLPQFWCQ 2049
            :.:.|:.||:..::|...... ||..|...|.|:....:......|..|...|.:...|...||.
 Frog  1634 ITSFLQHHLFGLDLPSCQEED-EFTVLSNCLGLLPSFSEASHQFVSASLLDWPVSAFDLISQWCS 1697

  Fly  2050 Q--LMEVRPPADTVRELVLINQHSLWQQPRLLELPREYERLFTYYHERPCLNCYKVPKESSICLL 2112
            :  |...:.| |...  ||:.|.:.|..||||:||..|..:|.|||.:.|..|.||||:.::||:
 Frog  1698 EVNLFSDKHP-DQAN--VLLIQDTKWDLPRLLQLPENYNTIFQYYHRKCCSVCTKVPKDPALCLV 1759

  Fly  2113 CGTIVCLKQNCCAENDCCEAVRHTLSCGGGIGIFLVVTSTYIIVIRGRRACLWGSLYLDDFDEED 2177
            |||.||||..||.:...||.|.|:.:||.|.||||::.::.||:|||.|.|||||:|||...|||
 Frog  1760 CGTFVCLKGLCCKQQSYCECVLHSQNCGAGTGIFLLINASVIIIIRGHRFCLWGSVYLDAHGEED 1824

  Fly  2178 RDLKRGKPLYLSKDRFNLLESQWLSHKFAHTKHTWVFH 2215
            |||:||||||:.|:|:::||.||:||.|.|....|..|
 Frog  1825 RDLRRGKPLYICKERYSMLEQQWVSHTFDHINKRWGPH 1862

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubr3NP_001259317.1 zf-UBR 224..291 CDD:280386 47/67 (70%)
FliJ <1410..1477 CDD:280262 26/67 (39%)
ubr3XP_012826536.1 zf-UBR 82..149 CDD:280386 47/67 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48694368
eggNOG 1 0.900 E1_KOG1139
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H52092
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005892
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.790

Return to query results.
Submit another query.