DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(1)G0193 and CG31664

Sequence 1:NP_572427.1 Gene:l(1)G0193 FlyBaseID:FBgn0027280 Length:664 Species:Drosophila melanogaster
Sequence 2:NP_001356905.1 Gene:CG31664 FlyBaseID:FBgn0051664 Length:606 Species:Drosophila melanogaster

Alignment Length:649 Identity:293/650 (45%)
Similarity:408/650 (63%) Gaps:56/650 (9%)


  Fly    12 LATLVALQQPTLTDALIEDVLDIIHVVKEVTSGVLKAWDIVQSSPLAANIDFPLMREKQKKVLQR 76
            ||||:|..:|.             |..|                      .:.||.|:.|   ..
  Fly    11 LATLLAFGKPA-------------HAYK----------------------TYYLMGEEDK---IH 37

  Fly    77 LKEVSKQIDNTEDQHAQYVALAIESVTSFMHNNAPIMAKMNDISDTINRISSRYQQMQKYEAYKD 141
            |.::.|:||...| |....|.:|.| .::::.:...::.:.::..|.:.||..|::|:|:|:  .
  Fly    38 LDKIFKEIDKLND-HTHIPAYSIGS-NNYVNESVVGVSDLLEMFYTFSWISKHYKKMRKFES--A 98

  Fly   142 KLEMSTLITFAEWTVSPNAHSVHHLMDRLHITLLGNEDRSSNTTSTNLLQQLATAYEVSTDQICN 206
            :.|..|.:..||..|..........|:::::.....:|..|.....|....|.|         |.
  Fly    99 EWENVTQLNLAEAQVFTGDEGNLQSMEKIYLKFFEKDDLISRMALFNQQFHLYT---------CK 154

  Fly   207 TMQSAQQFIYSLYADIALTELKAYTMMEFSWMMLRVYGKGNYTQEAEIMRSEYEKRTERTLKILK 271
            |.||.|||:|..|....:.||||:.::|:||::||.:|:|...:|.:..|:.|::|||.||..:|
  Fly   155 TPQSPQQFLYHFYVKYIIQELKAHALVEWSWLLLRKFGRGGSIEEEQASRAAYKRRTEGTLPKIK 219

  Fly   272 DVMLRADRIVYRCDPTKHVRGVTYDEVTRLLQGYIENEVDLNKEETCRETCDFYQSTRSEGCFKD 336
            .:|.:|||.|:||||.:|..|||::|||||||||:|||||||.:..|.:.|.:|:..::||||.:
  Fly   220 VLMSQADRSVWRCDPQEHQSGVTHEEVTRLLQGYVENEVDLNSDGACNQECGYYKLAKNEGCFDN 284

  Fly   337 LYCSRQPKCSGRLYNCRFVDSDMWVCPSPQNSTRRYEFIEYENGRVLGQRGKCTRGTTKVDSWWR 401
            .:||.||||:|.:::||||:|:|.:|.:.:||:||||||:||:|.|.|....|........||.|
  Fly   285 KFCSEQPKCTGGVHDCRFVESNMKICQAEKNSSRRYEFIKYESGLVHGNEKPCATWLNSAKSWNR 349

  Fly   402 YLLWHCSYCFCLCDEEGLKSDRFFNLRDTIADVKRNRVVTGLRFVKQNRIFHLQIQEGELLPRGI 466
            :|...||||.||||::..:|||:||||..|||||.||||.||||||:|||||||:|||||||.|.
  Fly   350 WLFMECSYCLCLCDDQSPQSDRYFNLRPVIADVKNNRVVVGLRFVKRNRIFHLQVQEGELLPLGD 414

  Fly   467 VNQSTLEWKPVEKYNVFDRHVKNGVDYHKLSYEKRTIDLDDVDTDDNSFVVTGVRFRVVGTHLNL 531
            :|.:||.||||:.|::.|:.|...||||.|:||||:|||.|::...|| ||||:||||.|.||.|
  Fly   415 INGTTLRWKPVDSYSISDKDVSENVDYHTLTYEKRSIDLGDLNAKINS-VVTGLRFRVFGAHLQL 478

  Fly   532 EAYYSEFDFRTGQLIRPEYNSYWKSNDNTDVSGARREKLRLSNADVSTRTIAHSIPLSRHNQYID 596
            ||.::..:|.:|:||.|:..|:|.|. .||   ..||:|.|.:|.|||::...|||....||:|:
  Fly   479 EAQFTAVEFESGKLIDPKKTSHWISM-GTD---QPRERLPLMDAQVSTKSSVLSIPYPSDNQFIE 539

  Fly   597 FTNTGLDKDAAQSTVPFMDIQDVVSNPPVPLAGIGIYYKGRNGYGGFLGPKIITYDFMPHVQVP 660
            |||||..:||||.||||:|||||||:|||||:||||||||::||||||.|:||||||..:||:|
  Fly   540 FTNTGFVQDAAQRTVPFIDIQDVVSDPPVPLSGIGIYYKGQDGYGGFLAPRIITYDFTSYVQIP 603

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(1)G0193NP_572427.1 Tar 10..>136 CDD:223910 27/124 (22%)
DUF4803 202..456 CDD:292679 134/254 (53%)
CG31664NP_001356905.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C141230972
eggNOG 1 0.900 E1_2CM7A
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR47890
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.