DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hdm and RFA1

DIOPT Version :8

Sequence 1:NP_572422.1 Gene:hdm / 31705 FlyBaseID:FBgn0029977 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_009404.1 Gene:RFA1 / 851266 SGDID:S000000065 Length:621 Species:Saccharomyces cerevisiae

Alignment Length:394 Identity:75/395 (19%)
Similarity:142/395 (36%) Gaps:94/395 (24%)


  Fly    68 DCVDEYAAMLQIGHVVDIVGAKVMSIPFAAPGEQRYQPQATVSCALVVNEGSGYVVRHDNDDFGQ 132
            |...::..:||.|.|..:..||:          |..:||.|       |....|.:..|.|    
Yeast   240 DFATKFNEILQEGKVYYVSKAKL----------QPAKPQFT-------NLTHPYELNLDRD---- 283

  Fly   133 ITILQQLLHQPIRPLG--AVLKLADVRSGLGFPDKIITTNVNLLVVVAAVRPVRQIKRKLQGPLS 195
             |::::...:...|..  ..:||..::      ::.:.:||::|.::..:.|..::       .|
Yeast   284 -TVIEECFDESNVPKTHFNFIKLDAIQ------NQEVNSNVDVLGIIQTINPHFEL-------TS 334

  Fly   196 EVQELLQCLEVIVIDASYPEGMLLSVWQPDWIQRAQQWQ-PRRTVLHLIDVRVSYSNF-HRSLVL 258
            ...:.....::.::|.|   |..:||..  |.|:|..:. |..:|..:..|||  ::| .:||.:
Yeast   335 RAGKKFDRRDITIVDDS---GFSISVGL--WNQQALDFNLPEGSVAAIKGVRV--TDFGGKSLSM 392

  Fly   259 SHSNCTLICENPQ------------AAGDDCRLL-------LAFAATVPLTTFSGCDQAELDNMP 304
            ..|: ||| .||:            :.|.:...:       :...:...||.|            
Yeast   393 GFSS-TLI-PNPEIPEAYALKGWYDSKGRNANFITLKQEPGMGGQSAASLTKF------------ 443

  Fly   305 AVASIQAQMTVRQIYSRAEGELQDPSIHQFTAVLYGMVTKFDLDGLTSHVNRKCIACQQHIPRNL 369
                |..::|:.:..:...|..:........|.:  ...|.|.....:..|..|.......|...
Yeast   444 ----IAQRITIARAQAENLGRSEKGDFFSVKAAI--SFLKVDNFAYPACSNENCNKKVLEQPDGT 502

  Fly   370 QDCASDACQQYFSLDNDEPRSISYFNINIHLSDQTGTLVEARLAGHPAERILGLRAEDFERLAER 434
            ..|  :.|      |.:..|....:.:.|.:.|:|..| ...|....|:::||:.|.....|.|.
Yeast   503 WRC--EKC------DTNNARPNWRYILTISIIDETNQL-WLTLFDDQAKQLLGVDANTLMSLKEE 558

  Fly   435 EKSE 438
            :.:|
Yeast   559 DPNE 562

Known Domains:


GeneSequenceDomainRegion External IDIdentity
hdmNP_572422.1 None
RFA1NP_009404.1 rpa1 3..617 CDD:273177 75/395 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1599
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.