DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hdm and RPA1

DIOPT Version :8

Sequence 1:NP_572422.1 Gene:hdm / 31705 FlyBaseID:FBgn0029977 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_024306631.1 Gene:RPA1 / 6117 HGNCID:10289 Length:618 Species:Homo sapiens

Alignment Length:144 Identity:36/145 (25%)
Similarity:60/145 (41%) Gaps:38/145 (26%)


  Fly   315 VRQIYSRAEGELQDPSIHQFTAVLYGMVTKFDLDGLTSHVNRKCIACQ--QHIPR---------N 368
            |.::|..::|.|:..: .|||||      |.|.: :|.:.....:.|:  .|:|.         :
Human   253 VNKVYYFSKGTLKIAN-KQFTAV------KNDYE-MTFNNETSVMPCEDDHHLPTVQFDFTGIDD 309

  Fly   369 LQDCASDA-------CQQYFSLDNDEPRSIS--YFNINIHLSDQTGTLVEARLAGHPAER----- 419
            |::.:.|:       |:.|........||.:  ....||:|.|.:|.:|.|.|.|..|::     
Human   310 LENKSKDSLVDIIGICKSYEDATKITVRSNNREVAKRNIYLMDTSGKVVTATLWGEDADKFDGSR 374

  Fly   420 -----ILGLRAEDF 428
                 |.|.|..||
Human   375 QPVLAIKGARVSDF 388

Known Domains:


GeneSequenceDomainRegion External IDIdentity
hdmNP_572422.1 None
RPA1XP_024306631.1 rpa1 48..614 CDD:273177 36/145 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1599
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.