DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hdm and rpa1

DIOPT Version :8

Sequence 1:NP_572422.1 Gene:hdm / 31705 FlyBaseID:FBgn0029977 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001015732.1 Gene:rpa1 / 548449 XenbaseID:XB-GENE-945047 Length:609 Species:Xenopus tropicalis

Alignment Length:50 Identity:17/50 (34%)
Similarity:22/50 (44%) Gaps:12/50 (24%)


  Fly   389 RSISYFNINIHLSDQTGTLVEARLAGHPAER----------ILGLRAEDF 428
            |.:|..|||  |.|.:|.:|...|.|..|::          |.|.|..||
 Frog   331 REVSKRNIN--LMDSSGKVVSTTLWGEDADKFDGSRQPVVAIKGARLSDF 378

Known Domains:


GeneSequenceDomainRegion External IDIdentity
hdmNP_572422.1 None
rpa1NP_001015732.1 RFA1 3..603 CDD:333227 17/50 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1599
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.