DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hdm and RpA-70

DIOPT Version :8

Sequence 1:NP_572422.1 Gene:hdm / 31705 FlyBaseID:FBgn0029977 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_524274.1 Gene:RpA-70 / 40972 FlyBaseID:FBgn0010173 Length:603 Species:Drosophila melanogaster

Alignment Length:373 Identity:65/374 (17%)
Similarity:129/374 (34%) Gaps:145/374 (39%)


  Fly    75 AMLQIGHVVDIVGAKVMSIP--FAAPGEQRYQPQATVSCALVVNEGSGY-----------VVRHD 126
            |.:..|.|||....::::|.  .:|...:||:        :::::|..:           |::| 
  Fly    12 ARIMHGEVVDAPVLQILAIKKINSAADSERYR--------ILISDGKYFNSYAMLASQLNVMQH- 67

  Fly   127 NDDFGQITILQQLLHQPIRPLGAVLKLADVRSGLGFPDKIITTNV-------NLLVV--VAAVRP 182
            |.:..:.||:|.                         ||.:|:.|       .:|::  :..|.|
  Fly    68 NGELEEFTIVQL-------------------------DKYVTSLVGKDGAGKRVLIISELTVVNP 107

  Fly   183 VRQIKRKLQGPLSEVQELLQCL-----------------------EVIVIDASYPEGML-----L 219
            ..::|.|:..|::......|.|                       ..||:::|...||.     |
  Fly   108 GAEVKSKIGEPVTYENAAKQDLAPKPAVTSNSKPIAKKEPSHNNNNNIVMNSSINSGMTHPISSL 172

  Fly   220 SVWQPDWIQRA--------QQWQPRR-----TVLHLID----VRVS------------------- 248
            |.:|..|:.:|        :.|...|     ..:.|:|    :|.:                   
  Fly   173 SPYQNKWVIKARVTSKSGIRTWSNARGEGKLFSMDLMDESGEIRATAFKEQCDKFYDLIQVDSVY 237

  Fly   249 -------------YSNFHRSLVLSHSNCTLI--CENPQAAGDDCRLLLAFAATVPLTTFSGCD-Q 297
                         ||:.:.:..::.|..|::  ||:.    ||..:.......||::..||.: :
  Fly   238 YISKCQLKPANKQYSSLNNAYEMTFSGETVVQLCEDT----DDDPIPEIKYNLVPISDVSGMENK 298

  Fly   298 AELDNM---PAVASIQA--QMTVRQIYSRAEGELQDPSIHQFTAVLYG 340
            |.:|.:   ..|..:|:  ..|..:.:.:.:..|.|.|....:..|:|
  Fly   299 AAVDTIGICKEVGELQSFVARTTNKEFKKRDITLVDMSNSAISLTLWG 346

Known Domains:


GeneSequenceDomainRegion External IDIdentity
hdmNP_572422.1 None
RpA-70NP_524274.1 rpa1 3..595 CDD:273177 65/374 (17%)
Rep-A_N 6..107 CDD:281980 22/129 (17%)
RPA1_DBD_A 168..270 CDD:239920 14/102 (14%)
RPA1_DBD_B 301..401 CDD:239921 9/47 (19%)
Rep_fac-A_C 444..589 CDD:285809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1599
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.