DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hdm and meiob

DIOPT Version :8

Sequence 1:NP_572422.1 Gene:hdm / 31705 FlyBaseID:FBgn0029977 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_021328187.1 Gene:meiob / 101882335 ZFINID:ZDB-GENE-120104-8 Length:466 Species:Danio rerio

Alignment Length:491 Identity:133/492 (27%)
Similarity:221/492 (45%) Gaps:67/492 (14%)


  Fly    10 LAEMRPTMTRFSTVALIVSKSSPNIFYDKMS-GTERGVLSLTIRDSPNHLTNCKCWGQRDCVDEY 73
            ::::...:|....|.:|:.|:....|.|:.: |:||...|.||:|||.|..|...||..:.:...
Zfish    12 ISDLNINITHSKVVGVIIGKTDSRGFPDRKNVGSERFTFSFTIKDSPEHFINVSAWGNEEYIQAL 76

  Fly    74 AAMLQIGHVVDIVGAKVMSIPFAAPGEQRYQPQATVSCALVVNE-GSGYVVRHDNDDFGQITILQ 137
            :...|||..|.|....|::..:..  |:|:.|....|..|::.| .|...:..|.|...:|.   
Zfish    77 SCRFQIGDCVVIENPLVVTKDYEK--EERFCPSTPSSYRLLLTETHSSIRICSDIDTEARIL--- 136

  Fly   138 QLLHQPIRPLGAVLKLADV-RSGLGFPDKIITTNVNLLVVVAAVRPVRQIK--RKLQGPLSEVQE 199
            .|.|.||:.......|.|: .:|......:|.       ::|||:.|.:.|  .|..|...    
Zfish   137 PLFHIPIKDPRDFYSLGDITANGQSLDGHVIN-------ILAAVQSVGEEKFFTKSGGCKG---- 190

  Fly   200 LLQCLEVIVID---ASYPEGMLLSVWQPDWIQRAQQWQPRRTVLHLIDVRVSYSNFHRSLVLSHS 261
              |.:|:.:.|   .|:|    ...|..:.|:..|....|.|||.:.|.|:::.:|.:|:|.:..
Zfish   191 --QRIEIKLFDDTGRSFP----FVCWDKENIRLVQTLTQRETVLFIADARITFDSFRKSMVATAI 249

  Fly   262 NCTLICENPQAAGDDCRLLLAFAATVPLTTFSGCDQAEL---DNMPAVASIQAQMTVRQIYSRAE 323
            :.|:|..||..|  :...|..|..  .|....|.|..:.   |:: .:.||:..|||.|:.:|::
Zfish   250 SKTIITVNPDTA--EANQLYTFVR--ELLQSGGLDDQDFLSGDDV-LLDSIRDVMTVSQLKTRSQ 309

  Fly   324 GELQDPSIHQFTAVLYGMVTKFDLDGLTSH-VNRKCIACQQHIPRNLQDCASDACQQYFSLDNDE 387
             |..| :||   .::||.:|.|||....|. :.::|..|:..|......|:||.|..    ...|
Zfish   310 -ENAD-AIH---CIIYGFITCFDLGSSPSKIITKRCARCKFRINEESWTCSSDICPN----QGQE 365

  Fly   388 PRSISYFNINIHLSDQTGTLVEARLAGHPAERILGLRAEDFERLAEREKSELKWRFLLKYFEVRL 452
            .::...|::.:.:||.||||....|.|..||:.||.:.|:|..|:|.:::.|:|:|||:..::.|
Zfish   366 LQANECFDVLVDISDHTGTLQSCNLVGTVAEKTLGCKTEEFLCLSEYQRTSLQWKFLLERCKIYL 430

  Fly   453 MI-------------------KKPVGVRNHLVIVVV 469
            .:                   ..||.|:.:|...||
Zfish   431 KVLPSPRRRSGMKADILSCGLADPVEVKQNLASFVV 466

Known Domains:


GeneSequenceDomainRegion External IDIdentity
hdmNP_572422.1 None
meiobXP_021328187.1 RFA1 <112..427 CDD:333227 97/349 (28%)
RPA_2b-aaRSs_OBF_like 166..266 CDD:324543 30/119 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C250605372
eggNOG 1 0.900 E1_COG1599
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H102013
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D277291at33208
OrthoFinder 1 1.000 FOG0007330
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_135668
Panther 1 1.100 LDO PTHR21166
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.720

Return to query results.
Submit another query.