powered by:
Protein Alignment ND-MNLL and ndufb1
DIOPT Version :9
| Sequence 1: | NP_001162693.1 |
Gene: | ND-MNLL / 31697 |
FlyBaseID: | FBgn0029971 |
Length: | 56 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_002933251.1 |
Gene: | ndufb1 / 100485816 |
XenbaseID: | XB-GENE-982989 |
Length: | 58 |
Species: | Xenopus tropicalis |
| Alignment Length: | 40 |
Identity: | 16/40 - (40%) |
| Similarity: | 26/40 - (65%) |
Gaps: | 1/40 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 17 LGFAIGHFLDKKETERMTMFRDKSALYGRPAGSEGKAPSW 56
:||.||.:||::..|:::.||:||.||.|.. ..|:..:|
Frog 19 VGFVIGWYLDRRNDEKLSTFRNKSMLYKREL-KPGEEVTW 57
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0007979 |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
1 |
1.000 |
- |
- |
|
X5921 |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.