DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir7c and Gria3

DIOPT Version :10

Sequence 1:NP_572411.1 Gene:Ir7c / 31692 FlyBaseID:FBgn0029966 Length:625 Species:Drosophila melanogaster
Sequence 2:NP_058582.4 Gene:Gria3 / 53623 MGIID:95810 Length:888 Species:Mus musculus


Alignment Length:36 Identity:10/36 - (27%)
Similarity:17/36 - (47%) Gaps:5/36 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 VLMNATTSFGIFCWFNRNTVPHMITRHCHWLSHREA 282
            :.|:...|||.    :..:..|::..|| |..:.||
Mouse   348 LFMHPDLSFGT----HTGSCGHIMHSHC-WQRYFEA 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir7cNP_572411.1 Lig_chan-Glu_bd 225..287 CDD:214911 10/36 (28%)
Lig_chan 343..592 CDD:459656
Gria3NP_058582.4 PBP1_iGluR_AMPA_GluR3 29..403 CDD:380610 10/36 (28%)
PBP2_iGluR_AMPA 416..799 CDD:270433
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.