DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10920 and Mtch1

DIOPT Version :8

Sequence 1:NP_572408.2 Gene:CG10920 / 31688 FlyBaseID:FBgn0029963 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_063933.1 Gene:Mtch1 / 56462 MGIID:1929261 Length:389 Species:Mus musculus

Alignment Length:404 Identity:107/405 (26%)
Similarity:159/405 (39%) Gaps:78/405 (19%)


  Fly    11 GQAEGLGLGGGDADNSVRMRHPTPPPLAVQHARSGAMVVELAVDPSRAMRSTNQQQPIDRDQLRI 75
            |...|.|..|| |...|..|...|||....|.|.    ...|..||..........|...|  ..
Mouse    21 GAGAGAGARGG-APAGVEARARDPPPAHRAHPRH----PRPAAQPSARRMDGGPGAPGSGD--NA 78

  Fly    76 STEESCQGSELVVASSHLSKKIQEHRRPNQLVRFCLRLGYNTLLYPYEMAKVLIQLGHEPLQAKP 140
            .|.|:     |.||                     |..|...|.:|....|:|||:||||:  .|
Mouse    79 PTTEA-----LFVA---------------------LGAGVTALSHPLLYVKLLIQVGHEPM--PP 115

  Fly   141 FVMRLIQRRPRLFLPSVHRYVQHIQHIDGYTGMYRGLTARLAASIVDYLLGDLLLATLHFAPYKR 205
            .:...:..|..|:|||...|.::|..:||..|::|||:.||.::         .|:|:.....|:
Mouse   116 TLGTNVLGRKVLYLPSFFTYAKYIVQVDGKIGLFRGLSPRLMSN---------ALSTVTRGSMKK 171

  Fly   206 --GPKE----------GLSLKEFWWNLTRNSLRITTVVVITHPFYVVMVRQIAQFVGGEHVYEGL 258
              .|.|          ..|||:.....:...:......::.||.:|:.:|.:.||||.|..|.|:
Mouse   172 VFPPDEMEQVSNKDDMKTSLKKVVKETSYEMMMQCVSRMLAHPLHVISMRCMVQFVGREAKYSGV 236

  Fly   259 VGSLMTLAQQEGCAGLFAGMVPRLLGEWSVLFITSALSHLCRRLL-----------------PMS 306
            :.|:..:.::||..|.|.|::|.|||:...|:..:.|:|.....|                 |.|
Mouse   237 LSSIGKIFKEEGLLGFFVGLIPHLLGDVVFLWGCNLLAHFINAYLVDDSVSDTPGGLGNDQNPGS 301

  Fly   307 ELQ-----HQYNTAVIQMMASLVAYPLEVTSTCMAGTGAPLTACEPPSMPLYNHWVDCLTDLYAR 366
            :..     ..|...|:.:..|::.||..:....||.....|.|..||..|::..|:.|...|..:
Mouse   302 QFSQALAIRSYTKFVMGIAVSMLTYPFLLVGDLMAVNNCGLRAGLPPYSPVFKSWIHCWKYLSVQ 366

  Fly   367 GGQNRGAILFWRTV 380
            |...||:.|.:|.|
Mouse   367 GQLFRGSSLLFRRV 380

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10920NP_572408.2 Mito_carr 231..>284 CDD:278578 20/53 (38%)
Mtch1NP_063933.1 Mito_carr 76..173 CDD:332982 37/136 (27%)
Solcar 1 81..176 36/132 (27%)
Solcar 2 192..280 25/88 (28%)
Mito_carr 206..>264 CDD:332982 21/58 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C361469832
eggNOG 1 0.900 E1_KOG2745
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1439019at2759
OrthoFinder 1 1.000 FOG0002923
OrthoInspector 1 1.000 T131006
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10780
Phylome 1 0.910 0.851 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
98.810

Return to query results.
Submit another query.